KEGG   Zymoseptoria tritici: MYCGRDRAFT_37911Help
Entry
MYCGRDRAFT_37911  CDS       T02285                                 

Definition
profilin
Orthology
K05759  
profilin
Organism
ztr  Zymoseptoria tritici
Brite
Exosome [BR:ztr04147]
 Exosomal proteins
  Proteins found in most exosomes
   MYCGRDRAFT_37911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 157 aa AA seqDB search
MLTRAVNSIRRHQVNRFHSLIVHRSNVHKLTLSNSLVGTGNLDKAAIFNSEGNSVWATSA
GFQVSPQEMQAIVAAYKDPGTDGVKKVQSEGLHVAGERFVVIKADDRSIYGKKGREGVVI
VKTTQAILVTHYPESVQPGAATNTVETLGDYLVKVGY
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgctaacacgagcggtcaacagcatacgtcgacaccaggtaaaccgattccactcgctg
attgtccatcgatccaacgtccacaaactgacactctccaacagccttgttggcactggc
aacctcgacaaggccgcgatcttcaacagcgaaggcaacagcgtatgggcaacaagtgca
ggcttccaggtgtcaccacaagagatgcaagctatcgttgcggcgtacaaagacccgggt
acggatggtgtgaagaaggtgcagagcgagggacttcacgttgcgggcgagcgcttcgtt
gtgatcaaggcggacgacaggagtatctacggaaagaagggccgtgagggcgtcgtcatc
gtcaagaccacccaagctatcctcgtcacacattacccggagtccgtccagccaggtgcc
gccaccaacaccgtagagacgctcggagactacctggtcaaggttggatactag

DBGET integrated database retrieval system