KEGG   Zymoseptoria tritici: MYCGRDRAFT_38697Help
Entry
MYCGRDRAFT_38697  CDS       T02285                                 

Gene name
MgTpk1
Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ztr  Zymoseptoria tritici
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ztr04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 382 aa AA seqDB search
MSQSSSAEKENTAAREEEKQKLSEWEAEKRPLEVEEIAVDPEKKPVGHSSKLLRKEDFEL
IKTLGTGTFARVWLVRLANQKNTSNNEYTKKVFALKILRKVDVIRLKQVEHVRNERNVLA
AVAGHPFITTMVASFQDADTLYMLLDYCPGGEVFSYLRRARRFNEATSQFYAAEIVLILE
FLHEKEGVAYRDLKPENILIDADGHLKLVDFGFAKKIAGRETYTLCGTPEYLAPEVIRNT
GHGLAVDWWAFGILIYEFLVGQPPFWDQNPMKIYEQIVEGKVRYPSAMSEDARDIIGGLC
TVDVSKRLGNVKGGAATVRSHPWFKNIDWDELYHRKMQGPIVPHLRSADDTRNFDDYDPE
PEKRDPYTKELQDKHERMFADF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagcagtagtgccgagaaggaaaacacggccgcacgggaagaggagaagcag
aaactgtcagaatgggaagcagaaaagcggccgctggaggtggaagagattgccgtggat
cctgagaagaaacccgtcggacactcgagcaagctgttacgcaaggaggattttgagctg
atcaagactctgggaactggcacattcgcgcgagtctggttggtgagattggcgaatcag
aagaacacgagcaacaacgaatacacgaaaaaggtctttgcgttaaagattttgcgcaag
gtggatgtgatacgactgaagcaggtggagcatgtacgcaacgagcgcaatgttctggct
gctgttgcaggacaccccttcataacgaccatggtcgccagctttcaggatgcagacaca
ctgtatatgctgctggactactgcccggggggcgaggtcttttcctacctacgacgagcg
agacgattcaatgaggcaacgtcacaattctacgccgccgagattgtgttgatactggag
ttcttgcacgagaaggaaggcgttgcgtatcgtgacttgaagccggagaatatattgatc
gatgctgatggacacttgaaattggtggattttgggttcgcgaagaagatcgctggacga
gaaacatacacactctgcggcacacccgaatacctcgcgcccgaagtcattcgaaacaca
ggccacggcctcgcagtagattggtgggcctttggaatcctcatatacgaattcctggtc
ggacaaccgcctttctgggaccagaacccgatgaagatctacgagcagattgtcgaggga
aaagtgcggtacccaagtgcaatgtcggaggacgcacgcgatatcataggtggtctttgt
accgttgatgtttccaaaagacttggaaatgtcaagggaggtgctgctacagtgaggtca
catccttggttcaagaatatagattgggacgagttataccacaggaagatgcaagggccg
atcgtgccacatctacggtccgcggacgatacgcggaattttgacgactatgatccggag
cctgagaaacgggatccgtatacaaaggaactgcaagacaaacatgaacgcatgtttgca
gacttttaa

DBGET integrated database retrieval system