KEGG   Zymoseptoria tritici: MYCGRDRAFT_38697Help
Entry
MYCGRDRAFT_38697  CDS       T02285                                 

Gene name
MgTpk1
Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ztr  Zymoseptoria tritici
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    MYCGRDRAFT_38697 (MgTpk1)
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     MYCGRDRAFT_38697 (MgTpk1)
Protein kinases [BR:ztr01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   MYCGRDRAFT_38697 (MgTpk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 382 aa AA seqDB search
MSQSSSAEKENTAAREEEKQKLSEWEAEKRPLEVEEIAVDPEKKPVGHSSKLLRKEDFEL
IKTLGTGTFARVWLVRLANQKNTSNNEYTKKVFALKILRKVDVIRLKQVEHVRNERNVLA
AVAGHPFITTMVASFQDADTLYMLLDYCPGGEVFSYLRRARRFNEATSQFYAAEIVLILE
FLHEKEGVAYRDLKPENILIDADGHLKLVDFGFAKKIAGRETYTLCGTPEYLAPEVIRNT
GHGLAVDWWAFGILIYEFLVGQPPFWDQNPMKIYEQIVEGKVRYPSAMSEDARDIIGGLC
TVDVSKRLGNVKGGAATVRSHPWFKNIDWDELYHRKMQGPIVPHLRSADDTRNFDDYDPE
PEKRDPYTKELQDKHERMFADF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagcagtagtgccgagaaggaaaacacggccgcacgggaagaggagaagcag
aaactgtcagaatgggaagcagaaaagcggccgctggaggtggaagagattgccgtggat
cctgagaagaaacccgtcggacactcgagcaagctgttacgcaaggaggattttgagctg
atcaagactctgggaactggcacattcgcgcgagtctggttggtgagattggcgaatcag
aagaacacgagcaacaacgaatacacgaaaaaggtctttgcgttaaagattttgcgcaag
gtggatgtgatacgactgaagcaggtggagcatgtacgcaacgagcgcaatgttctggct
gctgttgcaggacaccccttcataacgaccatggtcgccagctttcaggatgcagacaca
ctgtatatgctgctggactactgcccggggggcgaggtcttttcctacctacgacgagcg
agacgattcaatgaggcaacgtcacaattctacgccgccgagattgtgttgatactggag
ttcttgcacgagaaggaaggcgttgcgtatcgtgacttgaagccggagaatatattgatc
gatgctgatggacacttgaaattggtggattttgggttcgcgaagaagatcgctggacga
gaaacatacacactctgcggcacacccgaatacctcgcgcccgaagtcattcgaaacaca
ggccacggcctcgcagtagattggtgggcctttggaatcctcatatacgaattcctggtc
ggacaaccgcctttctgggaccagaacccgatgaagatctacgagcagattgtcgaggga
aaagtgcggtacccaagtgcaatgtcggaggacgcacgcgatatcataggtggtctttgt
accgttgatgtttccaaaagacttggaaatgtcaagggaggtgctgctacagtgaggtca
catccttggttcaagaatatagattgggacgagttataccacaggaagatgcaagggccg
atcgtgccacatctacggtccgcggacgatacgcggaattttgacgactatgatccggag
cctgagaaacgggatccgtatacaaaggaactgcaagacaaacatgaacgcatgtttgca
gacttttaa

DBGET integrated database retrieval system