KEGG   Zymoseptoria tritici: MYCGRDRAFT_40170Help
Entry
MYCGRDRAFT_40170  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     MYCGRDRAFT_40170
    1.3.1.94  polyprenol reductase
     MYCGRDRAFT_40170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 315 aa AA seqDB search
MLDAVLLLRAIYLSAALLVLLISSIPPLRTRFLAYGPRAAKAKTEAPEAQSKSWHAFHAL
LDIAAKICVPHSWFTSFYAVSVSLSLFWASEVVFQGPAFRTVAQHLAHRQCTMSFEQVAV
IWLMMFIQGSRRLYECLVLSAPSKSKMWIGHWALGLLFYVATSVAVWVEGSAALQAHSFS
TKDLTIKGPSIRTCIGILIFILASGVQHDCHAYLASLKKPRRTAKGEMKIEYRLPEHPVF
NLSLTPHYFAECLIYLSLSILAAPEGEWLNWTLVSALVFVAVNLGVTANGTRKWYAVKFG
TETVKGRARMIPGLY
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgctagatgcggtgctactattgcgtgcgatatacctcagtgctgcattgctggtattg
ttgatatcttctatacctcctttgcgcactcgatttttggcatatggtcctcgcgcggcg
aaggccaagactgaggctccagaagcgcagtctaagagctggcatgcttttcatgcattg
ctagacattgctgctaagatctgtgtgccgcacagctggttcacttcattctatgccgtc
tctgtctcgctttcgctcttctgggcgtcagaggtcgtgttccaagggccggcattccgt
acagtggcccaacacctagcacatcgacaatgtacgatgagtttcgagcaagttgctgtg
atttggcttatgatgttcatccaaggtagtcgcaggctgtatgagtgcctcgtcctgtcg
gctccctcgaagtcgaagatgtggattggtcattgggcgttgggcctcctcttttacgtg
gctaccagcgttgcagtctgggtggaaggatctgcagcactgcaagcgcacagcttctca
acgaaagacctcaccatcaaggggccaagcatccgaacttgcatcggcattctgatcttc
atcctcgcatccggtgtgcagcacgactgtcacgcctatcttgcgtccctgaagaaaccc
cgaaggacagcaaagggcgagatgaagattgaatacaggctgccagagcatccagtcttc
aacttgtcgctcacaccgcactacttcgccgagtgcctgatatacttgtcactgtccata
ctggcggcgcctgaaggagagtggctgaattggacattggtctctgcgctggtctttgtg
gcggtgaatttgggtgttactgccaatggcacgaggaagtggtacgcggtcaagtttggc
acagagactgtcaaaggaagagccaggatgatacccgggctgtattga

DBGET integrated database retrieval system