KEGG   Zymoseptoria tritici: MYCGRDRAFT_40511Help
Entry
MYCGRDRAFT_40511  CDS       T02285                                 

Gene name
HAG2402
Definition
histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MYCGRDRAFT_40511 (HAG2402)
Transcription machinery [BR:ztr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     MYCGRDRAFT_40511 (HAG2402)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 421 aa AA seqDB search
MSSTKEDKRKAEDEIEHDPKRLKPSVSPPPSDDTPTIRHELFPEKPAVTEERNGDISFRV
VNNDGQNSSFIILTGLKCIFQKQLPKMPKDYIARLVYDRTHLSIAIVKKPPAGSFAESSG
LPGEVVGGITYRPFKGRQFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATSDVMYFLTY
ADNYAIGYFKKQGFTKEITLDKPKWMGYIKDYEGGTIMQCSMLPKIRYLESGRMLLKQKA
AVHAKIRAVSKSYEIHQPPSEWRKVKPGQPLPEIDPLTIDAIKATGWSPDMDVLARQPRR
NPSHSLLLGLLSALQTSSSAWPFLQPVNGEEVHDYYDVIKEPMDLSTMESKLEKDQYENV
EDFVKDVLLLVRNCKRYNAETTPYAKAANKLEKEMWKKVREVPEWSYLEADNFETTNRQP
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaccaaggaagacaagcgcaaagccgaagacgaaatcgagcacgatcctaag
cgactcaagccctcagtatcgcctccaccaagcgacgacacacccaccatccgacacgag
ctcttccccgagaagcccgccgtgacagaagagcgcaacggcgacatctcattccgcgtg
gtcaacaatgacggccagaactcctccttcatcatcctcacaggcctgaagtgcatcttc
cagaagcaattacccaagatgccaaaggactacatcgcgcgattggtatacgatcgcacg
cacttgagcatcgcaatcgtgaagaagcctccagcaggaagctttgccgaaagctctggt
cttcccggagaagtcgttggaggcattacatatcgaccattcaagggtcgccagttcgcg
gagattgtcttctgtgctatcagcagcgaccagcaagtcaaaggatacggcgcacatctc
atgagccacctcaaagactacgtcaaggccacgagcgatgtcatgtacttcctcacctac
gccgacaactacgctatcgggtactttaagaagcaaggattcacaaaggagatcacactg
gacaaaccgaaatggatgggctacatcaaggattacgagggaggaacaatcatgcagtgt
tccatgctgccgaagattaggtatctcgaatcaggtcgcatgctgctgaagcaaaaggcc
gcagttcacgccaaaattcgtgctgtcagcaaaagttacgagatacaccagccgccgtca
gaatggcgcaaagtgaaacctggacaaccgctgccggagatcgatcctctgaccatcgat
gcgatcaaggctacagggtggtcgccagacatggacgttctcgcacggcagcctcgtcgt
aatccttcacacagcttactcctcggtttgctgtccgcactccagacaagttcttctgcg
tggcctttcctgcagcctgttaacggtgaagaagtgcacgactattacgacgtgatcaaa
gagcccatggatctgagtacgatggagagtaagcttgagaaggatcagtacgagaatgtg
gaggactttgtcaaggacgtcctcctcctggtgcgcaactgtaagcgctacaacgctgaa
acgacaccctacgcaaaagctgcaaataaactcgaaaaggaaatgtggaaaaaggtccgc
gaagtgccagagtggagttatctggaagccgacaatttcgagacgacaaatcggcagcct
gagtag

DBGET integrated database retrieval system