KEGG   Zymoseptoria tritici: MYCGRDRAFT_41254Help
Entry
MYCGRDRAFT_41254  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K13941  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00790  Folate biosynthesis
ztr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYCGRDRAFT_41254
Enzymes [BR:ztr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MYCGRDRAFT_41254
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MYCGRDRAFT_41254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_bind HPPK
Motif
Other DBs
NCBI-GeneID: 13399509
NCBI-ProteinID: XP_003853232
JGI: Mycgr3_41254
UniProt: F9X8N8
Position
4
AA seq 548 aa AA seqDB search
MSDAQGIEKLTNFWDLAFQNVIRPIATATDCDIRGLTALRTEVRLGLEKYINTSVLNKVR
CRRIRARWDPDDTSQEHRKIVEDEGRKEPHWRRNVFLALGSNVGDRFRNIEDACDKLDEC
QDIRIIDTSPLYETEPMYVEDQDRFLNGVCQIETTLAPMDLLDRLQAIENDLGRVKFIDK
GPRNIDLDIIAYDQEIINNERLIVPHLLMTEREFVLRPLCDLSSGRSWHHPATRLTATKH
LNKLPRSKIPMSSVTPLAPLCESLRALDPHRRTHVMSILNITPDSFSDGGVHALSDISAL
KATILSHVAAGATIIDIGGQSSRPNAPDVTEEEEMNRILPAIEAIKSLPEAAHIAISVDT
YRASVAEAAVNAGAHIINDISAGLLDPDMLSTIARLKCIYIMMHMRGTPATMQSQVNTTY
MGQVNHKVRRELVERLQAAREAGIRCWKIILDPGIGFAKTAEQNVELLRDFKQLRNNAMV
RTVPWLVGSSRKGFIGQITGTKVAADRVGGTAATVVQAVAGGADIVRVHDVETMTQVVRM
SDAMYRGM
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatgcgcagggcattgaaaagctgaccaatttttgggaccttgcattccaaaac
gtcattcgcccaattgccacagcgactgactgcgacatccgtgggctgacggcgctgagg
acggaagttcgcctcggcctcgaaaagtacatcaacaccagtgtcttgaacaaagtgaga
tgtaggaggattagagcaagatgggatccagatgataccagccaggaacaccggaagatc
gttgaggatgaaggacggaaagagccacattggcgacgaaacgtcttcttggccctggga
agcaacgttggtgatcgattccgaaacattgaagacgcctgcgataagcttgacgaatgt
caagacattcgaattatcgatactagccccctgtacgagacggagccgatgtacgtcgag
gatcaggatcgcttcctcaatggcgtgtgccagattgaaacaactcttgcgccaatggac
ctactagaccgccttcaagccatcgagaatgacctcggacgagtcaagttcatcgacaaa
ggccctcgcaacattgatctggacatcattgcctacgatcaggagattatcaacaacgag
cgcttgattgtgcctcatctcctgatgacagaacgcgaattcgtcttgcgtccgctatgc
gatctcagtagcggtcgaagttggcaccatccagcaacacgattgaccgccactaagcat
ctgaacaagctgccccgttccaaaattccgatgtcttctgtgacacctctagcaccgttg
tgcgagtcactgcgggctttagatcctcaccgtcggacgcacgtcatgtcgattctgaac
ataacgccggactcgttctccgatggcggcgtgcatgcactgtcggacatttctgctttg
aaagcaacgatcctgtcacacgttgcggctggcgcaaccatcatcgacatcggcggtcag
tcctcccgtccgaatgcaccagacgtcaccgaagaggaagaaatgaatcgcattctgccg
gccatcgaagccatcaaatctctgccagaagctgcgcatatcgccatctcggtcgacacc
tatcgcgcgtctgtggctgaagcagctgtcaacgctggtgcacacatcatcaacgatatc
tctgctggcctgcttgatcctgatatgctctctacgatcgctcgactcaagtgcatatat
atcatgatgcacatgcgtggaactccagcaacgatgcagtctcaagtcaacacgacctac
atgggtcaggtcaaccacaaggtgcgtagagaactagtcgagcgtctccaggccgctcgc
gaagccgggatccgttgctggaaaatcatccttgaccccggcatcggattcgccaagaca
gcggaacagaacgtggagcttttacgggacttcaagcagctcagaaacaacgcgatggtg
agaaccgtaccctggctagtaggaagcagccgaaaaggtttcatcggccagatcactggc
acgaaggtagcggccgacagagtgggaggtaccgcagccactgtcgtgcaagcagttgcg
ggtggagctgatatcgtgagggttcatgatgttgagactatgacacaagtggtgaggatg
tccgacgccatgtacagaggtatg

DBGET integrated database retrieval system