KEGG   Zymoseptoria tritici: MYCGRDRAFT_41254Help
Entry
MYCGRDRAFT_41254  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ztr  Zymoseptoria tritici
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ztr00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 548 aa AA seqDB search
MSDAQGIEKLTNFWDLAFQNVIRPIATATDCDIRGLTALRTEVRLGLEKYINTSVLNKVR
CRRIRARWDPDDTSQEHRKIVEDEGRKEPHWRRNVFLALGSNVGDRFRNIEDACDKLDEC
QDIRIIDTSPLYETEPMYVEDQDRFLNGVCQIETTLAPMDLLDRLQAIENDLGRVKFIDK
GPRNIDLDIIAYDQEIINNERLIVPHLLMTEREFVLRPLCDLSSGRSWHHPATRLTATKH
LNKLPRSKIPMSSVTPLAPLCESLRALDPHRRTHVMSILNITPDSFSDGGVHALSDISAL
KATILSHVAAGATIIDIGGQSSRPNAPDVTEEEEMNRILPAIEAIKSLPEAAHIAISVDT
YRASVAEAAVNAGAHIINDISAGLLDPDMLSTIARLKCIYIMMHMRGTPATMQSQVNTTY
MGQVNHKVRRELVERLQAAREAGIRCWKIILDPGIGFAKTAEQNVELLRDFKQLRNNAMV
RTVPWLVGSSRKGFIGQITGTKVAADRVGGTAATVVQAVAGGADIVRVHDVETMTQVVRM
SDAMYRGM
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatgcgcagggcattgaaaagctgaccaatttttgggaccttgcattccaaaac
gtcattcgcccaattgccacagcgactgactgcgacatccgtgggctgacggcgctgagg
acggaagttcgcctcggcctcgaaaagtacatcaacaccagtgtcttgaacaaagtgaga
tgtaggaggattagagcaagatgggatccagatgataccagccaggaacaccggaagatc
gttgaggatgaaggacggaaagagccacattggcgacgaaacgtcttcttggccctggga
agcaacgttggtgatcgattccgaaacattgaagacgcctgcgataagcttgacgaatgt
caagacattcgaattatcgatactagccccctgtacgagacggagccgatgtacgtcgag
gatcaggatcgcttcctcaatggcgtgtgccagattgaaacaactcttgcgccaatggac
ctactagaccgccttcaagccatcgagaatgacctcggacgagtcaagttcatcgacaaa
ggccctcgcaacattgatctggacatcattgcctacgatcaggagattatcaacaacgag
cgcttgattgtgcctcatctcctgatgacagaacgcgaattcgtcttgcgtccgctatgc
gatctcagtagcggtcgaagttggcaccatccagcaacacgattgaccgccactaagcat
ctgaacaagctgccccgttccaaaattccgatgtcttctgtgacacctctagcaccgttg
tgcgagtcactgcgggctttagatcctcaccgtcggacgcacgtcatgtcgattctgaac
ataacgccggactcgttctccgatggcggcgtgcatgcactgtcggacatttctgctttg
aaagcaacgatcctgtcacacgttgcggctggcgcaaccatcatcgacatcggcggtcag
tcctcccgtccgaatgcaccagacgtcaccgaagaggaagaaatgaatcgcattctgccg
gccatcgaagccatcaaatctctgccagaagctgcgcatatcgccatctcggtcgacacc
tatcgcgcgtctgtggctgaagcagctgtcaacgctggtgcacacatcatcaacgatatc
tctgctggcctgcttgatcctgatatgctctctacgatcgctcgactcaagtgcatatat
atcatgatgcacatgcgtggaactccagcaacgatgcagtctcaagtcaacacgacctac
atgggtcaggtcaaccacaaggtgcgtagagaactagtcgagcgtctccaggccgctcgc
gaagccgggatccgttgctggaaaatcatccttgaccccggcatcggattcgccaagaca
gcggaacagaacgtggagcttttacgggacttcaagcagctcagaaacaacgcgatggtg
agaaccgtaccctggctagtaggaagcagccgaaaaggtttcatcggccagatcactggc
acgaaggtagcggccgacagagtgggaggtaccgcagccactgtcgtgcaagcagttgcg
ggtggagctgatatcgtgagggttcatgatgttgagactatgacacaagtggtgaggatg
tccgacgccatgtacagaggtatg

DBGET integrated database retrieval system