KEGG   Zymoseptoria tritici: MYCGRDRAFT_46160Help
Entry
MYCGRDRAFT_46160  CDS       T02285                                 

Gene name
RBK1
Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ztr  Zymoseptoria tritici
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MYCGRDRAFT_46160 (RBK1)
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MYCGRDRAFT_46160 (RBK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 343 aa AA seqDB search
MATTSDPRPTITILGSLNIDFITLTPRLPSPGETLSATSFTTGYGGKGANQAVACARLSP
PDYHVRMLGKVGDDTFGGEYLDALRKEGMDVEGVRIVQGGKTGVTNIIVEEGTGENRILF
VANANQEFEAEENLVNSRNGAAGRREVVVLQLEIPLETVLHNLSLASTAGSHTIFNPAPA
IPLPDSAYPHISTLIMNETEAGIISSSSSSSTTSSSSPTNKQEEEAEPSIPSLLTLAKSF
LARGVKETVIITLGGKGLVYATRAGGEGHVEAESVKVVDTTAAGDTFVGGYAVQRAKALV
EEVEGEKEWDVARALGFATKAAARTVERAGAMSAIPYLKEVEL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacctccgatccccgcccaacaatcacaatcctcggctccctcaacatagac
ttcataaccctcactccccggctcccctcccccggcgaaaccctctccgccacctccttc
acaaccggctacggcggcaaaggcgccaatcaagccgtcgcctgcgcccgtctctcccct
cccgactaccacgtccggatgctgggcaaggtcggcgacgacacgttcggaggggagtac
ctggacgctctgaggaaggagggcatggatgtggaaggcgtgaggatcgtgcaggggggg
aagacgggggtgacgaatattattgttgaggaagggacgggggagaatcgcattttattc
gtggcgaatgcgaatcaggagtttgaagcggaggaaaacttggtcaattcgcgaaatgga
gcggcggggaggagggaagttgtggtgctgcaattggaaatcccactcgagactgtcctc
cacaacctctccctcgcctccacagcaggctcccacacaatcttcaaccccgcacccgcc
atccccctaccggactccgcatacccccacatctccacgctcatcatgaacgaaaccgaa
gcgggcatcatctcctcctcctcatcgtcttccaccacctcctcatcatctcccaccaat
aaacaggaggaagaagcggaaccctccatcccctccctcctcaccctcgcgaaatccttc
ctcgcccgcggcgtcaaggaaaccgtcatcatcacgctcggcggtaaagggctcgtctac
gctacccgtgccggcggcgaaggacacgtggaagcggagagtgtcaaagttgtcgacacg
acggctgcgggcgatactttcgttggcgggtatgcggtgcaaagggccaaggcgttggta
gaggaggtagagggggaaaaggagtgggatgtggcgagggcgttggggtttgctacgaag
gcggcggcgaggacggtggagagggcaggggctatgagtgcgattccgtatctgaaagag
gtggaattgtag

DBGET integrated database retrieval system