KEGG   Zymoseptoria tritici: MYCGRDRAFT_46388Help
Entry
MYCGRDRAFT_46388  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ztr  Zymoseptoria tritici
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYCGRDRAFT_46388
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MYCGRDRAFT_46388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 224 aa AA seqDB search
MSPFITSAPAVDFDGLSWPSTGTLARLHEKENPAEAEARLQKLSGAVRTILECIGEDPDR
EGLHGTPERYAKAMMFFTKGYEENLRDIVNGAVFHEDHDELVIVKDIEVYSLCEHHLVPF
TGKMHIGYIPSQRVIGLSKLARIAEMFSRRLQVQERLTKQVALALSEVLKPQGVAVVMES
THMCMVMRGVQKAGSVTTTSCMLGAMRKRAKTREEFLSLLGRRM
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccttcatcacatccgctcctgccgtagactttgacggactatcatggccgagt
acaggcacactagcgagacttcatgagaaggagaacccagcagaagcagaagcgagatta
caaaagctatcaggagcagtgcggactatattggagtgcattggcgaggatccggatcga
gaaggtctgcacggcacgccggagcgatatgcaaaagctatgatgttcttcaccaaaggc
tacgaggagaatttacgggacattgtcaatggtgccgtgttccatgaggaccatgacgaa
ctggtgattgtgaaggatatcgaggtgtacagtctgtgcgagcatcatctcgtgcccttc
acgggcaagatgcacattggctacattccttcgcaaagagtgattggtctttcaaagctc
gctcgcattgctgagatgttcagtcgacgcttgcaggtgcaggagcgattgacgaagcaa
gtagccttggctctctccgaagtgctcaaacctcaaggtgttgctgtagtgatggaaagc
acacacatgtgtatggtcatgcgtggcgttcaaaaggcgggatctgtgacaacgacgagc
tgtatgctgggtgccatgcggaaaagagcgaagaccagagaggagttcttgagtctgctt
ggaaggcggatgtaa

DBGET integrated database retrieval system