KEGG   Zymoseptoria tritici: MYCGRDRAFT_47547Help
Entry
MYCGRDRAFT_47547  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
ztr  Zymoseptoria tritici
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MYCGRDRAFT_47547
   00240 Pyrimidine metabolism
    MYCGRDRAFT_47547
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MYCGRDRAFT_47547
   03410 Base excision repair
    MYCGRDRAFT_47547
   03420 Nucleotide excision repair
    MYCGRDRAFT_47547
   03430 Mismatch repair
    MYCGRDRAFT_47547
   03440 Homologous recombination
    MYCGRDRAFT_47547
DNA repair and recombination proteins [BR:ztr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      MYCGRDRAFT_47547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 198 aa AA seqDB search
MPPKRRSNTPRTTQRQQGTLSFHGKSKVTKPTSPRGAKSKKDPEQYEQLLEKDIKPEVEE
PTTAEKAITEQVKAEVATLEDPLDTTISKTEDESEARKVSATQINKYWRAKEAERKAPRV
HQQDLSTHEKILREWDMSGNYGPCIGIARLKRWKRANMLGLNPPIEVLAVLLKELDGGEV
KSQRAHVDELMSSRFIET
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaacgccgctccaacacaccgcgcacgacacagcgtcaacagggaacactc
tccttccacggcaagagtaaagtcacaaaaccgacctctcctcgcggcgcaaagtcaaag
aaagatcccgagcagtacgagcaactactggagaaagatatcaagcccgaggtcgaagaa
cccaccaccgcagagaaagcaatcacagaacaagtcaaagctgaagtcgcaacactcgaa
gatcctctcgataccacaatcagcaagaccgaagatgagtctgaagcgaggaaggtttct
gcgacgcagatcaacaaatactggcgagcaaaggaggcggagcgaaaggcgccgcgggta
catcagcaggacttgagcacgcatgagaagattctgagggagtgggatatgagtgggaac
tatgggccctgcatcggaatagcacgcctgaagcgctggaagagagccaacatgcttggt
ctgaaccccccgatcgaagtcctcgctgttctgctgaaggagcttgatggtggggaagtc
aagtcgcagagagcgcatgtggatgagttgatgagctctcgctttatcgaaacatga

DBGET integrated database retrieval system