KEGG   Zymoseptoria tritici: MYCGRDRAFT_50144Help
Entry
MYCGRDRAFT_50144  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
ztr  Zymoseptoria tritici
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MYCGRDRAFT_50144
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MYCGRDRAFT_50144
Peptidases [BR:ztr01002]
 Metallo Peptidases
  Family M67
   MYCGRDRAFT_50144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11
AA seq 465 aa AA seqDB search
MALSRHHAALSRPLNVEEIVQEAQNFEFNPNRPLQQWIRAARMLLTEATVCEDEGNIAQA
YLYIYRHAELVLAKLPQHPDYRNPQFKAELSQARKTLQKNLVKMEEWKPRINQEHERYTK
IMARRDAERRLTQNELDEEAVHSHSRRGSYDMVGAMASTTTLNAHQDRRFAVDLAQKEIR
RRDASKRSTHQAGISPHTRMSRRPTNFDNISSYNLPPPSIPSKQALSPPPLPSKNPLSAP
ALPPKPSTSTSNPTQRYTFAPTATTESGSPLRPLLLPPSLRSSFLKLASTNTAHNLETCG
ILAATLISNALFITHLILPEQTSTPNTCDTTPAGDAALFSYVDSHALLVVGWIHTHPSQT
CFLSSRDLHTSAGYQVMLPESIAIVCAPGKDPDWGVFRLTEPPGLDAILGCTQTSAFHPH
QEGRLYTDALGGVGHVVEGPGLEFQVVDLRDGRGGEEEEMEGGWI
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggctctttcacggcatcatgccgcgctctcccgacctttgaacgtggaagagatcgtg
caagaagcacaaaatttcgagttcaacccaaatcgacctctacagcaatggatccgcgcc
gccagaatgctcctcacggaagccaccgtctgcgaggacgagggaaacatcgcgcaggcc
tatctctacatctatcgacatgcggaattggtgctggccaaattgccacaacatccggac
tacagaaatccgcagttcaaagcagagctctcgcaagcgaggaagacgctccagaagaac
cttgtcaaaatggaggagtggaaacctcgaatcaaccaggagcacgaacgatataccaaa
attatggctcgccgagatgcagagaggagattgactcaaaatgagctggatgaagaagcc
gtccattcacattcgcggagaggctcttatgacatggttggcgctatggcctcgacaact
actctcaacgcccatcaagaccggcgattcgctgtcgacttggcccagaaggaaattaga
agacgagatgcgagcaaacgatcgacccatcaagcaggcatctcaccgcatacccgcatg
tcaaggcgccccacaaacttcgacaacatatcatcctacaacctccctcccccctccatc
ccctccaaacaagccctctcccctccccctctcccctcaaaaaaccccctctccgcaccc
gccctcccacccaaaccctcaacctcaacctccaaccccacccaacgctacaccttcgcc
ccaacagcaaccaccgaatccggctcccccctccgccctctcctcctcccaccatccctc
cgttcctcattcctcaaactagcctcaacaaacaccgcccacaacctcgaaacctgcggc
atcctcgcggcgaccctcatctccaacgccctcttcatcacccacctcatcctccccgaa
cagacttccacccccaacacctgcgacaccactcccgccggcgacgccgcgctcttctct
tacgtcgactcccacgcccttctcgtggtcgggtggatacacacccatccttcgcaaaca
tgtttcctctcctcccgtgatctccacaccagcgcggggtatcaagtcatgctccccgag
tccatcgcgatcgtctgcgcgccgggcaaggatcccgactggggggttttcaggttgacg
gaaccgcctgggttggacgcgattttgggttgtacgcagacgagcgcgtttcatccgcat
caggaggggaggttgtatacggatgcgcttgggggggtgggacatgtggttgaggggccg
gggttggagtttcaggttgtggatttgagggatgggaggggtggggaggaggaggagatg
gaaggggggtggatttga

DBGET integrated database retrieval system