KEGG   Zymoseptoria tritici: MYCGRDRAFT_55380Help
Entry
MYCGRDRAFT_55380  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00520  Amino sugar and nucleotide sugar metabolism
ztr00531  Glycosaminoglycan degradation
ztr01100  Metabolic pathways
ztr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MYCGRDRAFT_55380
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    MYCGRDRAFT_55380
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    MYCGRDRAFT_55380
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MYCGRDRAFT_55380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Acetyltransf_1
Motif
Other DBs
NCBI-GeneID: 13403457
NCBI-ProteinID: XP_003855517
JGI: Mycgr3_55380
UniProt: F9X3S2
Position
2
AA seq 921 aa AA seqDB search
MDKTLGQLFMMGFEGTTVTPQIRKLIVEHHLGSILLTAKNLQSAEQCTALVLELQKTAYE
AGHSVPLLIGLDQENGGVNSLFDEIYIRQYPSAMGLAATGSKEIAYEVAKATAEEIAACG
LNLMMGPCLDVLTNVRNQPLGVRTTGDDPQEVSAYGIAFMKGYRDAGVSMMGKHFPSYGS
LEFLGSALDVPTITESLESLSLNALVPFRNAIKEGLDAMMVGGCAMSSAGLNVMHACLSE
QVVNDLLRVDLKFDGVVISDCLEMDALSHNIGVGGGTVMAINAGCDIVLLCRSYAHQQEA
IEGFKLGVENAMISKARLRQSLQRVLDMKAKCTSWEKALNPAGIPLLSRLQPSHTTLSTK
AYNSSITVVRDKNRLLPLTNIMEPEDELLLLTPLVKPLVASAASRQLSEQATNGSPEPAV
WERSASVMSGERVFRELGRSLARQRSGRVLHTSYTANGVRPQHENLINRASAIIIVTADA
NRNLYQHGFTKHVSMICNMHYTSGGERREKPLIVVSVSSPYDFAMDQSIGTYICTYDFTE
TALMSLVKVLYGDFVPAGTLPGALSQSHKISQSKQHWLVESFNEERDSTALDALITACND
ATPPGLRSHLASATNNSFLLHNPSILEAHYVVRNSSTHTLYGFCATYHFTATGTGVIAAL
FVDPSRRKLSIGHSLHSRALRTLLQREGVKRFQLGSRLPSLYLGIPTGQHTSDRKRLRSW
FADLGWNTALSRSVCSMVARNLSTWSPPDGMAKSLQSANVDFDLVYGWDYAGPVLDHIKT
NNRQGLAEVYKLALADPAACGIIRAKRPEDGALVGTVVLYNMQSTLAEFVPASREVGDGG
TVGGISSPVISPSVGEYSTLLQGLILLGMRQVKAQGCGACLLDYMDGDGNFDGLSAMGFS
VLHGFEEVSCDAATWTMVPPT
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggacaagactctcggccagctcttcatgatgggcttcgaaggaaccaccgtcacgccc
caaatccgcaaactcatcgtcgaacaccacctcggcagcatccttctcacggccaaaaac
ctgcagtccgccgaacaatgcaccgccctcgtcctcgaactccagaagaccgcgtacgaa
gccggtcattcggtcccgctactcatcggtctggaccaagaaaatggcggcgtcaactcc
ctcttcgacgagatttacatccgacagtatccctctgctatgggtctcgcggcgacaggc
agcaaggagattgcgtatgaagtcgctaaggcgacggcggaggagattgcggcgtgtggg
ctgaatttgatgatgggtccatgtttggatgtgttgacgaatgtgaggaatcagccgttg
ggcgtgaggactacgggggatgatccgcaggaggtgagcgcgtatggaattgcgttcatg
aagggttatcgggatgcgggcgttagtatgatgggaaagcatttcccttcgtatgggagt
ctagagttcttgggttcggcgctggatgtaccgactatcactgagagcttggagtcgctc
agtctgaatgctctggtgccgttccgcaatgccattaaggaaggtctggatgctatgatg
gttggtggatgtgccatgtcttcagctggactgaatgtcatgcacgcttgtctgtccgag
caagtcgtgaacgatctgctacgagtcgacctcaaatttgacggtgtggtcatttcagac
tgccttgagatggatgctttgagccacaatatcggagttggaggagggaccgtcatggct
attaatgctgggtgtgacatcgtcctgctctgtcgatcatacgcgcatcaacaggaagct
attgagggcttcaagcttggggtggagaatgctatgatttcgaaagccaggttaaggcag
tcattgcagagggtgctcgatatgaaggcgaagtgcacttcgtgggagaaggcactcaat
ccagctggaatccctttgctatcgagactacagccctctcacaccacattgtcgacaaaa
gcgtacaactcgtcgatcaccgtggtgagggacaagaaccgacttctccctcttaccaac
attatggagcccgaggatgagttgctcctcttgactcccctcgtcaagccactggtcgcc
tcagctgcatcgagacagctgtcagagcaggcgacaaacggatcacctgaaccagccgtg
tgggagcggagtgcatccgtcatgtccggcgaacgagtcttccgcgagctaggacgctct
ctcgcacgccaacgaagcggccgcgtcctgcacacgtcctacaccgccaatggagttcgc
cctcagcatgaaaatctcatcaaccgggccagcgccatcatcatcgtcaccgccgatgcc
aatcgcaatctataccaacacggcttcaccaagcacgtctccatgatctgcaacatgcac
tacacctccggtggcgaacggcgcgagaaacccctcatcgtcgtctccgtctcctcaccc
tatgacttcgccatggatcagtccattggcacctacatctgcacgtacgacttcactgaa
accgccctcatgtccctcgtcaaagtcctctatggcgacttcgtccccgccggaactctc
cctggcgccctctcccaatcccacaagatctcccaatcaaagcaacactggctcgtggag
tccttcaacgaagaacgcgactcgaccgccttggacgccctcatcaccgcctgtaacgac
gctaccccaccgggcctccgctcgcacctcgcctccgcaaccaacaactctttcctccta
cacaacccctccatcctcgaagcccactacgtcgtccgcaactcctccacccacaccctc
tacggcttctgcgcaacctaccactttaccgccacgggaacaggcgtcatcgccgctcta
ttcgtcgacccttcccgccgcaaactctccatcggccactcccttcactcccgcgcgctc
cgtactctcctccaacgtgaaggcgtcaagcgcttccaacttggctcccgcttgccatct
ctctacctcggcatcccgacgggtcaacacacctccgaccgcaaacgtctccgctcgtgg
ttcgcagatctgggatggaacacggccctctctcgctccgtgtgcagtatggtcgcccgc
aatttgagcacgtggtcgccacctgacggcatggccaagagcttgcaaagtgcaaacgtc
gacttcgacctcgtctacggctgggactacgccggcccggtgctggaccacatcaaaacc
aacaatcgccaaggtctcgcggaagtgtacaagctcgccctcgcggacccggctgcgtgc
ggtatcattcgcgccaagaggccggaggatggtgccctggtcggcacggtggtgctgtac
aatatgcaatctacattagcggagtttgtgcccgcttcaagggaggtgggagatggtggg
acggtgggaggaattagtagtccggtcatcagtccgagtgtgggtgagtattcgacgttg
ttgcaaggattgattcttttggggatgaggcaggtcaaggcgcagggttgtggggcttgt
ttgttggattatatggatggggacgggaatttcgatggattgtcggcgatggggtttagt
gttttgcatggatttgaggaggtcagttgtgatgcggcgacttggactatggttcctccg
acttga

DBGET integrated database retrieval system