KEGG   Zymoseptoria tritici: MYCGRDRAFT_55380Help
Entry
MYCGRDRAFT_55380  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ztr  Zymoseptoria tritici
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ztr00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ztr00312]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 921 aa AA seqDB search
MDKTLGQLFMMGFEGTTVTPQIRKLIVEHHLGSILLTAKNLQSAEQCTALVLELQKTAYE
AGHSVPLLIGLDQENGGVNSLFDEIYIRQYPSAMGLAATGSKEIAYEVAKATAEEIAACG
LNLMMGPCLDVLTNVRNQPLGVRTTGDDPQEVSAYGIAFMKGYRDAGVSMMGKHFPSYGS
LEFLGSALDVPTITESLESLSLNALVPFRNAIKEGLDAMMVGGCAMSSAGLNVMHACLSE
QVVNDLLRVDLKFDGVVISDCLEMDALSHNIGVGGGTVMAINAGCDIVLLCRSYAHQQEA
IEGFKLGVENAMISKARLRQSLQRVLDMKAKCTSWEKALNPAGIPLLSRLQPSHTTLSTK
AYNSSITVVRDKNRLLPLTNIMEPEDELLLLTPLVKPLVASAASRQLSEQATNGSPEPAV
WERSASVMSGERVFRELGRSLARQRSGRVLHTSYTANGVRPQHENLINRASAIIIVTADA
NRNLYQHGFTKHVSMICNMHYTSGGERREKPLIVVSVSSPYDFAMDQSIGTYICTYDFTE
TALMSLVKVLYGDFVPAGTLPGALSQSHKISQSKQHWLVESFNEERDSTALDALITACND
ATPPGLRSHLASATNNSFLLHNPSILEAHYVVRNSSTHTLYGFCATYHFTATGTGVIAAL
FVDPSRRKLSIGHSLHSRALRTLLQREGVKRFQLGSRLPSLYLGIPTGQHTSDRKRLRSW
FADLGWNTALSRSVCSMVARNLSTWSPPDGMAKSLQSANVDFDLVYGWDYAGPVLDHIKT
NNRQGLAEVYKLALADPAACGIIRAKRPEDGALVGTVVLYNMQSTLAEFVPASREVGDGG
TVGGISSPVISPSVGEYSTLLQGLILLGMRQVKAQGCGACLLDYMDGDGNFDGLSAMGFS
VLHGFEEVSCDAATWTMVPPT
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggacaagactctcggccagctcttcatgatgggcttcgaaggaaccaccgtcacgccc
caaatccgcaaactcatcgtcgaacaccacctcggcagcatccttctcacggccaaaaac
ctgcagtccgccgaacaatgcaccgccctcgtcctcgaactccagaagaccgcgtacgaa
gccggtcattcggtcccgctactcatcggtctggaccaagaaaatggcggcgtcaactcc
ctcttcgacgagatttacatccgacagtatccctctgctatgggtctcgcggcgacaggc
agcaaggagattgcgtatgaagtcgctaaggcgacggcggaggagattgcggcgtgtggg
ctgaatttgatgatgggtccatgtttggatgtgttgacgaatgtgaggaatcagccgttg
ggcgtgaggactacgggggatgatccgcaggaggtgagcgcgtatggaattgcgttcatg
aagggttatcgggatgcgggcgttagtatgatgggaaagcatttcccttcgtatgggagt
ctagagttcttgggttcggcgctggatgtaccgactatcactgagagcttggagtcgctc
agtctgaatgctctggtgccgttccgcaatgccattaaggaaggtctggatgctatgatg
gttggtggatgtgccatgtcttcagctggactgaatgtcatgcacgcttgtctgtccgag
caagtcgtgaacgatctgctacgagtcgacctcaaatttgacggtgtggtcatttcagac
tgccttgagatggatgctttgagccacaatatcggagttggaggagggaccgtcatggct
attaatgctgggtgtgacatcgtcctgctctgtcgatcatacgcgcatcaacaggaagct
attgagggcttcaagcttggggtggagaatgctatgatttcgaaagccaggttaaggcag
tcattgcagagggtgctcgatatgaaggcgaagtgcacttcgtgggagaaggcactcaat
ccagctggaatccctttgctatcgagactacagccctctcacaccacattgtcgacaaaa
gcgtacaactcgtcgatcaccgtggtgagggacaagaaccgacttctccctcttaccaac
attatggagcccgaggatgagttgctcctcttgactcccctcgtcaagccactggtcgcc
tcagctgcatcgagacagctgtcagagcaggcgacaaacggatcacctgaaccagccgtg
tgggagcggagtgcatccgtcatgtccggcgaacgagtcttccgcgagctaggacgctct
ctcgcacgccaacgaagcggccgcgtcctgcacacgtcctacaccgccaatggagttcgc
cctcagcatgaaaatctcatcaaccgggccagcgccatcatcatcgtcaccgccgatgcc
aatcgcaatctataccaacacggcttcaccaagcacgtctccatgatctgcaacatgcac
tacacctccggtggcgaacggcgcgagaaacccctcatcgtcgtctccgtctcctcaccc
tatgacttcgccatggatcagtccattggcacctacatctgcacgtacgacttcactgaa
accgccctcatgtccctcgtcaaagtcctctatggcgacttcgtccccgccggaactctc
cctggcgccctctcccaatcccacaagatctcccaatcaaagcaacactggctcgtggag
tccttcaacgaagaacgcgactcgaccgccttggacgccctcatcaccgcctgtaacgac
gctaccccaccgggcctccgctcgcacctcgcctccgcaaccaacaactctttcctccta
cacaacccctccatcctcgaagcccactacgtcgtccgcaactcctccacccacaccctc
tacggcttctgcgcaacctaccactttaccgccacgggaacaggcgtcatcgccgctcta
ttcgtcgacccttcccgccgcaaactctccatcggccactcccttcactcccgcgcgctc
cgtactctcctccaacgtgaaggcgtcaagcgcttccaacttggctcccgcttgccatct
ctctacctcggcatcccgacgggtcaacacacctccgaccgcaaacgtctccgctcgtgg
ttcgcagatctgggatggaacacggccctctctcgctccgtgtgcagtatggtcgcccgc
aatttgagcacgtggtcgccacctgacggcatggccaagagcttgcaaagtgcaaacgtc
gacttcgacctcgtctacggctgggactacgccggcccggtgctggaccacatcaaaacc
aacaatcgccaaggtctcgcggaagtgtacaagctcgccctcgcggacccggctgcgtgc
ggtatcattcgcgccaagaggccggaggatggtgccctggtcggcacggtggtgctgtac
aatatgcaatctacattagcggagtttgtgcccgcttcaagggaggtgggagatggtggg
acggtgggaggaattagtagtccggtcatcagtccgagtgtgggtgagtattcgacgttg
ttgcaaggattgattcttttggggatgaggcaggtcaaggcgcagggttgtggggcttgt
ttgttggattatatggatggggacgggaatttcgatggattgtcggcgatggggtttagt
gttttgcatggatttgaggaggtcagttgtgatgcggcgacttggactatggttcctccg
acttga

DBGET integrated database retrieval system