KEGG   Zymoseptoria tritici: MYCGRDRAFT_58400Help
Entry
MYCGRDRAFT_58400  CDS       T02285                                 

Gene name
PDI
Definition
protein disulfide isomerase (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ztr  Zymoseptoria tritici
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ztr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 456 aa AA seqDB search
MVKSAQIAAVAASILLYGADAFYTKDSPVLQVESRTYDNLIAKSNHTSIVEFYAPWCGHC
KNLKPAYEKAAKSLSGLAKVAAVNCDEEANKPLCGRMEVKGFPTLKIVRPGKKPGRPVVE
DYNGERSAKGIVDAVIDKIPNHVKRLKDSDIEGWVAAGTTPKVLLFTDKGTVSALLKSVA
IDFLDGLEVGQVRNKETKAVEAYGVTKFPTLMLLPGDGKEPVKYDGELKKEAIVKFLSQA
ATPNPDPAPSKKKPKTDKKKDKDASSSSKFSKSSASQASKQAETDAAYQTDETIVDNPTD
SPSPEVDQEQKQKPINLPKPAPSIAQLAEELLLQHKCLNDKAGTCVLALLPEDSASEKTV
EAVQSLSDLHYKHKSAKRTLFPFYQIPASNAQAKALRTQLDLSPTEVEIIATNGKRSWWR
HYKGADFRLSGLEDWVDAIRMGDSPKSKMPDGLIVD
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagtcagcacagatcgccgctgttgcagcgtctatccttctctatggcgccgat
gctttctacacgaaagactctcctgtcctccaagtcgaatcacgaacgtacgacaacctg
atcgcaaagtcgaaccacacgagcattgtcgagttctacgcgccttggtgtggccattgc
aagaacctcaagccagcatacgagaaagctgccaagtcgctctctggtctggccaaggtc
gcggctgtgaactgcgatgaggaagccaacaagccgctatgcggcagaatggaagtcaag
ggctttcctactctcaagatcgttcgtcctggcaagaaacctgggaggccagttgtcgaa
gactacaacggggagcgcagtgcgaagggtatcgtggatgcagttatcgataagatcccc
aatcacgtcaagagattgaaagattcggacattgaaggctgggtggcagcaggtacaaca
ccaaaggtgcttctgttcacggacaagggtacggtcagcgcactgttgaagtcagttgcg
attgacttcttggatggcttggaagttgggcaggtcaggaacaaggagaccaaggctgta
gaggcgtacggtgtcacaaagtttccgacactgatgctcttacccggagatggaaaagag
cccgtgaaatacgacggtgagctgaagaaagaagccattgtcaagttcctctcgcaagca
gcgacaccgaacccagacccggccccaagcaagaagaagccaaagaccgataagaagaag
gacaaggatgcttcgtcgtcttccaagttctcgaaatcctcggcttcacaagcttcgaag
caggccgagacggacgccgcctaccagaccgacgaaaccatcgtcgataatcctacggac
tctcccagtcccgaagttgaccaagagcagaagcagaagccgatcaatctgcccaagcct
gccccgtcgattgcacagctggcagaggaactcttgctccagcacaaatgtctcaacgac
aaggctggaacctgcgtgctggctctgctacctgaagacagcgcttccgagaagactgtc
gaggctgtccaaagtctgagcgaccttcactacaagcacaagtcggccaagagaacactg
ttcccattctaccaaattccggcttcgaatgcccaagcaaaagctcttcgaacccagctc
gatctttccccaacagaggtcgagatcatcgctaccaacggcaagaggtcgtggtggagg
cactacaagggtgcggacttcagactctcgggactcgaagactgggtcgatgctatccgt
atgggtgactctccaaagtcaaaaatgccagatggcttgatcgtcgac

DBGET integrated database retrieval system