KEGG   Zymoseptoria tritici: MYCGRDRAFT_58400Help
Entry
MYCGRDRAFT_58400  CDS       T02285                                 

Gene name
PDI
Definition
protein disulfide isomerase (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ztr  Zymoseptoria tritici
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MYCGRDRAFT_58400 (PDI)
Enzymes [BR:ztr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MYCGRDRAFT_58400 (PDI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 456 aa AA seqDB search
MVKSAQIAAVAASILLYGADAFYTKDSPVLQVESRTYDNLIAKSNHTSIVEFYAPWCGHC
KNLKPAYEKAAKSLSGLAKVAAVNCDEEANKPLCGRMEVKGFPTLKIVRPGKKPGRPVVE
DYNGERSAKGIVDAVIDKIPNHVKRLKDSDIEGWVAAGTTPKVLLFTDKGTVSALLKSVA
IDFLDGLEVGQVRNKETKAVEAYGVTKFPTLMLLPGDGKEPVKYDGELKKEAIVKFLSQA
ATPNPDPAPSKKKPKTDKKKDKDASSSSKFSKSSASQASKQAETDAAYQTDETIVDNPTD
SPSPEVDQEQKQKPINLPKPAPSIAQLAEELLLQHKCLNDKAGTCVLALLPEDSASEKTV
EAVQSLSDLHYKHKSAKRTLFPFYQIPASNAQAKALRTQLDLSPTEVEIIATNGKRSWWR
HYKGADFRLSGLEDWVDAIRMGDSPKSKMPDGLIVD
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagtcagcacagatcgccgctgttgcagcgtctatccttctctatggcgccgat
gctttctacacgaaagactctcctgtcctccaagtcgaatcacgaacgtacgacaacctg
atcgcaaagtcgaaccacacgagcattgtcgagttctacgcgccttggtgtggccattgc
aagaacctcaagccagcatacgagaaagctgccaagtcgctctctggtctggccaaggtc
gcggctgtgaactgcgatgaggaagccaacaagccgctatgcggcagaatggaagtcaag
ggctttcctactctcaagatcgttcgtcctggcaagaaacctgggaggccagttgtcgaa
gactacaacggggagcgcagtgcgaagggtatcgtggatgcagttatcgataagatcccc
aatcacgtcaagagattgaaagattcggacattgaaggctgggtggcagcaggtacaaca
ccaaaggtgcttctgttcacggacaagggtacggtcagcgcactgttgaagtcagttgcg
attgacttcttggatggcttggaagttgggcaggtcaggaacaaggagaccaaggctgta
gaggcgtacggtgtcacaaagtttccgacactgatgctcttacccggagatggaaaagag
cccgtgaaatacgacggtgagctgaagaaagaagccattgtcaagttcctctcgcaagca
gcgacaccgaacccagacccggccccaagcaagaagaagccaaagaccgataagaagaag
gacaaggatgcttcgtcgtcttccaagttctcgaaatcctcggcttcacaagcttcgaag
caggccgagacggacgccgcctaccagaccgacgaaaccatcgtcgataatcctacggac
tctcccagtcccgaagttgaccaagagcagaagcagaagccgatcaatctgcccaagcct
gccccgtcgattgcacagctggcagaggaactcttgctccagcacaaatgtctcaacgac
aaggctggaacctgcgtgctggctctgctacctgaagacagcgcttccgagaagactgtc
gaggctgtccaaagtctgagcgaccttcactacaagcacaagtcggccaagagaacactg
ttcccattctaccaaattccggcttcgaatgcccaagcaaaagctcttcgaacccagctc
gatctttccccaacagaggtcgagatcatcgctaccaacggcaagaggtcgtggtggagg
cactacaagggtgcggacttcagactctcgggactcgaagactgggtcgatgctatccgt
atgggtgactctccaaagtcaaaaatgccagatggcttgatcgtcgac

DBGET integrated database retrieval system