KEGG   Zymoseptoria tritici: MYCGRDRAFT_60105Help
Entry
MYCGRDRAFT_60105  CDS       T02285                                 

Gene name
MgXYL1
Definition
endo-1,4-beta xylanase glycoside hydrolase family 11
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ztr  Zymoseptoria tritici
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 225 aa AA seqDB search
MLFTRALLGLAAATYSLAAPITEASPNPDSATHLFARESPGTGTNNGYYYSFWTDGGGQV
NYNNGPGGSYTVSWSNVGNFVAGKGWATGSARTINYSGSFNPSGNGYIAAYGWTRNPLIE
YYVVESYGTYNPSSAAQKKGTVTTDGGTYDILQTTRVNQPSIDGTQTFQQFWSVRQQKRV
GGTVTMKNHFDAWSRLGMKLGSSQNYQILATEGYQSSGSASITVS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctcttcacacgcgctctgctcggcctcgccgccgctacgtactctctggccgctccc
atcaccgaggcctctcccaacccggactcggccacccacctcttcgctcgcgagagcccg
ggcactggcacgaacaatggctactactactccttctggaccgacggtggaggccaagtg
aactacaacaatggcccgggcggctcgtacacggtctcgtggagcaacgttgggaacttc
gttgcgggcaagggttgggctacagggtctgctagaaccatcaactactccggctccttc
aacccctccggcaacggctacatcgccgcctacggctggacccgcaaccctctgatcgaa
tactacgtcgtcgaatcctacggcacctacaaccccagctctgcggctcagaagaaggga
accgtcaccaccgacggcggcacctacgatatcctccaaaccacccgcgtcaaccagccc
tccattgacggcacgcagacctttcagcaattctggagcgtgcgccagcagaagcgcgtc
ggcggcacggtgaccatgaagaaccacttcgacgcttggtcgaggctgggcatgaagctg
ggttcgtcgcagaactaccagattttggcgaccgagggataccagagcagcgggtctgcg
agcatcaccgtttcgtag

DBGET integrated database retrieval system