KEGG   Zymoseptoria tritici: MYCGRDRAFT_60105Help
Entry
MYCGRDRAFT_60105  CDS       T02285                                 

Gene name
MgXYL1
Definition
(RefSeq) endo-1,4-beta xylanase glycoside hydrolase family 11
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     MYCGRDRAFT_60105 (MgXYL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_11
Motif
Other DBs
NCBI-GeneID: 13402161
NCBI-ProteinID: XP_003851797
JGI: Mycgr3_60105
UniProt: F9XDM7
Position
6
AA seq 225 aa AA seqDB search
MLFTRALLGLAAATYSLAAPITEASPNPDSATHLFARESPGTGTNNGYYYSFWTDGGGQV
NYNNGPGGSYTVSWSNVGNFVAGKGWATGSARTINYSGSFNPSGNGYIAAYGWTRNPLIE
YYVVESYGTYNPSSAAQKKGTVTTDGGTYDILQTTRVNQPSIDGTQTFQQFWSVRQQKRV
GGTVTMKNHFDAWSRLGMKLGSSQNYQILATEGYQSSGSASITVS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctcttcacacgcgctctgctcggcctcgccgccgctacgtactctctggccgctccc
atcaccgaggcctctcccaacccggactcggccacccacctcttcgctcgcgagagcccg
ggcactggcacgaacaatggctactactactccttctggaccgacggtggaggccaagtg
aactacaacaatggcccgggcggctcgtacacggtctcgtggagcaacgttgggaacttc
gttgcgggcaagggttgggctacagggtctgctagaaccatcaactactccggctccttc
aacccctccggcaacggctacatcgccgcctacggctggacccgcaaccctctgatcgaa
tactacgtcgtcgaatcctacggcacctacaaccccagctctgcggctcagaagaaggga
accgtcaccaccgacggcggcacctacgatatcctccaaaccacccgcgtcaaccagccc
tccattgacggcacgcagacctttcagcaattctggagcgtgcgccagcagaagcgcgtc
ggcggcacggtgaccatgaagaaccacttcgacgcttggtcgaggctgggcatgaagctg
ggttcgtcgcagaactaccagattttggcgaccgagggataccagagcagcgggtctgcg
agcatcaccgtttcgtag

DBGET integrated database retrieval system