KEGG   Zymoseptoria tritici: MYCGRDRAFT_61567Help
Entry
MYCGRDRAFT_61567  CDS       T02285                                 

Gene name
HAG2401
Definition
elongator complex protein 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MYCGRDRAFT_61567 (HAG2401)
Transfer RNA biogenesis [BR:ztr03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MYCGRDRAFT_61567 (HAG2401)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 550 aa AA seqDB search
MRACADVANWLVEDFERSQQSGEKPKDVNLNSLRSQMAKKHFLSRQPPLTDIIAAVPEQH
KKYILPKLIAKPVRSASGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYT
GYEPTSMRAIRARYDPFEQARGRVDQIRNMGHSVDKVEYIIMGGTFMSLSPKYREEFISQ
LHNALSGYQTNDVDEAVMAGEQSTTKCIGITIETRPDYCLPPHLTDMLRYGCTRLEVGVQ
SLYEDVARDTNRGHTVKAVCETFCQAKDAGFKVVSHMMPDLPNVGLERDLFQFQEYFANP
AFRTDGLKIYPTLVIRGTGLYELWRTGRYKNYTPNVLIDIVARILALIPPWTRIYRVQRD
IPMPLVTSGVENGNLRELALARMKDFGTTCRDVRTREVGINEVKHKIRPNQVELVRRDYV
ANGGWETFLAYEDPKQDILIALLRLRKCSEKYTYREELIGQPSSLVRELHVYGSAVPIHE
RVKGKSQHQGYGTLLMEEAARIARDEHGSRKISVISGVGVRGYYKRLGYWLDGPYMSKWL
DAEAEDSDDD
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcatgtgccgatgtagcgaactggctggtcgaagatttcgagaggtcgcaacag
agtggagagaaaccaaaggacgtcaacctgaactctctgcgcagtcagatggcaaagaag
cacttcctctcacgacaaccgcctttgacagacatcatcgctgcggtacccgaacagcac
aagaagtacattcttccaaagttgatcgcgaagccagtgaggagtgccagtggtatcgcg
gtcgtagctgtgatgtgcaagccgcatagatgtccacacatcgcatacacaggcaacatt
tgcgtgtactgtccgggcggaccggattcagacttcgaatacagcacacaatcatacaca
ggatacgagccgacaagtatgagagccatcagagcccgatacgatccgtttgaacaagct
cgaggacgagtagaccagattcgcaatatgggacacagtgtggacaaggtggagtacatt
atcatgggagggacattcatgtccctgtctcccaagtatcgtgaggagttcatctctcaa
ctacacaacgccctatctggataccaaacgaatgatgtggacgaagctgtcatggcgggc
gagcaaagtacaacgaagtgtattggaatcacaatcgaaacacgaccggactactgtcta
ccgccacatcttacagacatgcttcgttatggctgcacgcgtttggaagtcggtgttcag
tcgctgtacgaggatgtcgctagggacacgaatcgaggacacaccgtgaaggccgtctgt
gagacgttctgtcaggcaaaggacgctggattcaaggtcgtctcacacatgatgccagat
cttcccaatgttggcctcgaacgcgaccttttccagttccaagaatacttcgccaaccca
gctttccgtactgacggtctgaagatctacccaacactggtcattcgaggcacaggactg
tatgagctgtggcgaacaggtcgatacaagaactacacacccaacgtgctcatcgatatt
gtggcacgcattttggcactcatcccaccttggacgagaatctaccgtgtacagcgtgac
attccaatgccgcttgtcacatcaggagtcgagaatggcaatctgcgagaactggcgctg
gctagaatgaaggactttggtaccacatgccgtgacgtacggactcgcgaagtaggcatc
aacgaagtgaagcacaagatccggccgaaccaggtcgagctcgtacggagggactacgtt
gcgaacggaggctgggagactttcctggcgtacgaggatccaaagcaggacatcctgatt
gcgctactgcggttgcgaaaatgcagcgagaagtacacatatcgggaggagctgatcggc
cagccatcgagtctggtccgcgaacttcacgtctatggctctgctgtgccgattcacgag
cgtgtaaagggcaagtcgcagcatcagggctacggcactttgctcatggaggaggctgcg
cggatcgccagagacgagcatggatcgagaaagatttcagtcatctcaggcgttggcgtg
cgaggttactacaagcggttgggctattggctcgacggaccatacatgagcaaatggctg
gatgctgaagcggaggacagcgacgacgattga

DBGET integrated database retrieval system