KEGG   Zymoseptoria tritici: MYCGRDRAFT_61567Help
Entry
MYCGRDRAFT_61567  CDS       T02285                                 

Gene name
HAG2401
Definition
(RefSeq) elongator complex protein 3
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MYCGRDRAFT_61567 (HAG2401)
Transfer RNA biogenesis [BR:ztr03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MYCGRDRAFT_61567 (HAG2401)
Chromosome [BR:ztr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    MYCGRDRAFT_61567 (HAG2401)
   HAT complexes
    Elongator complex
     MYCGRDRAFT_61567 (HAG2401)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 13394229
NCBI-ProteinID: XP_003850394
JGI: Mycgr3_61567
UniProt: F9XHM2
Position
8
AA seq 550 aa AA seqDB search
MRACADVANWLVEDFERSQQSGEKPKDVNLNSLRSQMAKKHFLSRQPPLTDIIAAVPEQH
KKYILPKLIAKPVRSASGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYT
GYEPTSMRAIRARYDPFEQARGRVDQIRNMGHSVDKVEYIIMGGTFMSLSPKYREEFISQ
LHNALSGYQTNDVDEAVMAGEQSTTKCIGITIETRPDYCLPPHLTDMLRYGCTRLEVGVQ
SLYEDVARDTNRGHTVKAVCETFCQAKDAGFKVVSHMMPDLPNVGLERDLFQFQEYFANP
AFRTDGLKIYPTLVIRGTGLYELWRTGRYKNYTPNVLIDIVARILALIPPWTRIYRVQRD
IPMPLVTSGVENGNLRELALARMKDFGTTCRDVRTREVGINEVKHKIRPNQVELVRRDYV
ANGGWETFLAYEDPKQDILIALLRLRKCSEKYTYREELIGQPSSLVRELHVYGSAVPIHE
RVKGKSQHQGYGTLLMEEAARIARDEHGSRKISVISGVGVRGYYKRLGYWLDGPYMSKWL
DAEAEDSDDD
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcatgtgccgatgtagcgaactggctggtcgaagatttcgagaggtcgcaacag
agtggagagaaaccaaaggacgtcaacctgaactctctgcgcagtcagatggcaaagaag
cacttcctctcacgacaaccgcctttgacagacatcatcgctgcggtacccgaacagcac
aagaagtacattcttccaaagttgatcgcgaagccagtgaggagtgccagtggtatcgcg
gtcgtagctgtgatgtgcaagccgcatagatgtccacacatcgcatacacaggcaacatt
tgcgtgtactgtccgggcggaccggattcagacttcgaatacagcacacaatcatacaca
ggatacgagccgacaagtatgagagccatcagagcccgatacgatccgtttgaacaagct
cgaggacgagtagaccagattcgcaatatgggacacagtgtggacaaggtggagtacatt
atcatgggagggacattcatgtccctgtctcccaagtatcgtgaggagttcatctctcaa
ctacacaacgccctatctggataccaaacgaatgatgtggacgaagctgtcatggcgggc
gagcaaagtacaacgaagtgtattggaatcacaatcgaaacacgaccggactactgtcta
ccgccacatcttacagacatgcttcgttatggctgcacgcgtttggaagtcggtgttcag
tcgctgtacgaggatgtcgctagggacacgaatcgaggacacaccgtgaaggccgtctgt
gagacgttctgtcaggcaaaggacgctggattcaaggtcgtctcacacatgatgccagat
cttcccaatgttggcctcgaacgcgaccttttccagttccaagaatacttcgccaaccca
gctttccgtactgacggtctgaagatctacccaacactggtcattcgaggcacaggactg
tatgagctgtggcgaacaggtcgatacaagaactacacacccaacgtgctcatcgatatt
gtggcacgcattttggcactcatcccaccttggacgagaatctaccgtgtacagcgtgac
attccaatgccgcttgtcacatcaggagtcgagaatggcaatctgcgagaactggcgctg
gctagaatgaaggactttggtaccacatgccgtgacgtacggactcgcgaagtaggcatc
aacgaagtgaagcacaagatccggccgaaccaggtcgagctcgtacggagggactacgtt
gcgaacggaggctgggagactttcctggcgtacgaggatccaaagcaggacatcctgatt
gcgctactgcggttgcgaaaatgcagcgagaagtacacatatcgggaggagctgatcggc
cagccatcgagtctggtccgcgaacttcacgtctatggctctgctgtgccgattcacgag
cgtgtaaagggcaagtcgcagcatcagggctacggcactttgctcatggaggaggctgcg
cggatcgccagagacgagcatggatcgagaaagatttcagtcatctcaggcgttggcgtg
cgaggttactacaagcggttgggctattggctcgacggaccatacatgagcaaatggctg
gatgctgaagcggaggacagcgacgacgattga

DBGET integrated database retrieval system