KEGG   Zymoseptoria tritici: MYCGRDRAFT_64960Help
Entry
MYCGRDRAFT_64960  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ztr  Zymoseptoria tritici
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MYCGRDRAFT_64960
   00052 Galactose metabolism
    MYCGRDRAFT_64960
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_64960
   00520 Amino sugar and nucleotide sugar metabolism
    MYCGRDRAFT_64960
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MYCGRDRAFT_64960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 522 aa AA seqDB search
MSSIPTKIKDALPTHLKPGNGAEGDRHHGKSQSHVAFENTSTSVAASQMRNALNNLSDGV
KDPALKKRFETEMDNFFALFRRYLNDKAKGNEIDWNRISPPKPEQVVDYNSLGNSESVDF
LGKLAVLKLNGGLGTSMGCVGPKSVIEVRDGMSFLDLSVRQIEHLNRTYDVNVPFVLMNS
FNTDADTASIIKKYEGHNIDILTFNQSRYPRILKDSLLPAPKSADSQISDWYPPGHGDVF
ESLYNSGILDKLIDRGVEILFLSNADNLGAVVDLNILQHMVETKAEYIMELTDKTKADVK
GGTIIDYEGQARLLEIAQVPKQYTNEFKSIKKFKYFNTNNIWMNLRAVKRIVENNELAME
IIPNGKTIPADKKGEADVNIIQLETAVGAAIRHFHNAHGVNVPRRRFLPVKTCSDLMLVK
SDLYTLKHGQLVMDPNRFGPAPLIKLGNDFKKVSNFQSRIPSIPKILELDHLTITGGVNL
GRGVVLKGTVIIVATEGSTIDIPPGSVLENVVVQGSLRLLEH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccattcccaccaagatcaaggacgcgcttcccacacacctgaagccaggcaat
ggcgccgagggtgaccgtcaccacggaaagtcgcagtcgcatgtggctttcgagaacaca
tccacatccgttgcggcttcgcagatgcgcaatgccctcaacaacctctcagatggcgtt
aaggacccagctctcaagaagcgcttcgagacggaaatggacaacttcttcgccctcttc
cgccgctacctcaacgacaaggccaagggcaacgagattgactggaaccgcatctcccca
ccaaagcctgagcaggtcgtcgactacaacagcctaggcaactccgagtcggtcgacttc
ctcggcaagctcgccgttctcaagctcaacggtggtctcggtacctccatgggctgcgtc
ggtcccaagtctgtcattgaggtccgcgacggcatgtctttcctcgatctctccgtccgc
cagattgagcacctcaaccgcacatacgacgtcaacgtcccattcgtcctcatgaactcg
ttcaacaccgacgccgacaccgcaagcatcatcaagaagtacgagggtcacaacattgac
atcctcaccttcaaccaatcccgctacccacgtatcctcaaggactcgctccttcccgca
ccaaagtccgccgactcgcaaatctccgactggtacccaccaggccacggtgacgttttc
gagtcgctctacaactctggcatcctcgacaaactcatcgaccgcggtgttgagattctc
ttcctctccaacgccgacaacctcggcgccgtggttgacctcaacatcctccagcacatg
gtcgagacaaaagcagagtacatcatggagttgacagacaagaccaaggctgatgtcaag
ggtggcaccatcatcgactacgagggtcaggctcgtctgttggagattgctcaagtcccc
aagcaatacaccaacgagttcaagagcatcaagaagttcaagtacttcaacaccaacaac
atctggatgaacctccgcgcggtcaagcgcatcgtcgagaacaacgagctcgccatggag
atcatccccaacggcaagactatccccgccgacaagaagggtgaggccgacgtcaacatc
atccaactcgagaccgccgtcggtgccgcgatccgtcacttccacaacgctcacggcgtg
aacgtgcctcgtcgccgtttcttgccagtcaagacctgctccgatctcatgctcgtcaag
tcggacctttacacgctcaagcacggccagctcgtgatggaccccaaccgtttcggccct
gctcctctcatcaagctcggcaacgacttcaagaaggtgtccaacttccagagccgcatc
ccttccattcccaagatcctcgagcttgatcatctcaccatcaccggaggtgtgaacctc
ggccgtggtgtcgtgctcaagggtaccgtcatcatcgtcgcgaccgagggctcgacgatc
gacattcctccgggttccgtgctcgagaacgtggtggtgcagggtagcttgagactgctc
gagcactag

DBGET integrated database retrieval system