KEGG   Zymoseptoria tritici: MYCGRDRAFT_65843Help
Entry
MYCGRDRAFT_65843  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K11843  ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MYCGRDRAFT_65843
Peptidases [BR:ztr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MYCGRDRAFT_65843
Ubiquitin system [BR:ztr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    MYCGRDRAFT_65843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 ubiquitin Ubiquitin_2
Motif
Other DBs
NCBI-GeneID: 13394604
NCBI-ProteinID: XP_003856199
JGI: Mycgr3_65843
UniProt: F9X0Y4
Position
1
AA seq 590 aa AA seqDB search
MAEIPIKVKHQGKVHDLTVDPASNGEELKMQLYSLTNVEPENQKILAKKLVKDDTPLSTL
GLKPGATITLVGNPSASVVFEAPKEKMKFSEDMTEAELARQAGAIPAGLQNMGNTCYANA
TLQTLRAVPELLDELKTYKPSAPAPGPSSSLFSADQLAQHGIGGLGGGNDLTSSLGELYR
QMSETQQGFPPLMFLTTLRQKFPQFAERAKSGHGYAQQDAEEVWSQVISTLNQTLKLKES
DATELGFKTWVEKYMGGKFEVKMTCDEAPEEEAAINNEDFNDLKCNIQAETNHMREGISI
ALNEKIEKNSPSLGRSAIYSRQSRISRLPKYLPIHFIRFFWRKDTGKKAKILRKVTFQHE
IDVTEFCTDELRKKLIPVRDKIREVRKDAEDIERAKKRQKRMQKEQEQNGDSNVRSDEPL
QKKKDKERERELKAKGLNGEAELAAEKKTAGEDTAMGGTEEKFKTDEEIEAERAASILAA
KKDLLSLVHPDMAKDSTANQTGLYELRALVTHQGSSADSGHYTAYVKKAAPAPGKEEDGK
WWWFNDDKVQEVESEKIETLSGGGETHSALILLYRAVPLPTITEAEQKAA
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattccaatcaaagtcaagcatcaaggcaaggtccatgaccttactgtcgac
cccgcctcaaatggagaagagttgaagatgcaactatattctctcacgaacgtcgagcca
gagaaccaaaagatcctcgcaaagaagctcgtcaaggatgacacgccgttgtccacgctc
ggcctcaagcctggcgctaccatcacactcgttggaaacccatccgcaagcgttgtattc
gaggcaccaaaagagaagatgaagttttcggaggacatgacggaagcagagctggcaaga
caggctggtgcgatacccgcgggactacagaacatgggaaacacttgctatgcaaacgcc
acgctgcaaacattgcgtgctgttcctgagctgcttgacgagttgaagacatacaagcct
agtgcgccagctccgggtccatcttcttctctcttctcggcagaccaactcgcgcagcac
ggtattggaggactgggtggtggcaacgacttgacgtcttctttgggagagctgtatcgg
cagatgagcgagactcagcagggcttcccgccgctcatgttcctcacaacattacgacag
aagtttccacagttcgccgagcgtgcaaagagtggacacggctatgctcagcaggatgcg
gaagaggtctggtctcaggtaatttccactctcaatcagactctcaagctgaaggagtcg
gacgccaccgaactgggcttcaagacttgggtggagaagtacatgggaggcaagtttgag
gtgaagatgacctgcgatgaggcacccgaggaggaagccgccattaacaatgaggacttc
aacgacttgaagtgtaacatccaggccgagacaaatcacatgcgagaaggcatcagtatc
gccctcaacgagaagatcgagaagaactcccccagcctgggacgaagtgccatctactcc
cgtcaatcgcgcatatcacgattgcccaagtaccttcccatccacttcatccgcttcttc
tggcgcaaggacaccggcaagaaggcaaagattctccgcaaggtcactttccagcacgag
atcgatgtcaccgagttctgcaccgatgagctccgtaagaagctcattcctgtgcgcgac
aagattcgcgaggtgaggaaggacgcggaggacattgagcgcgcgaagaagcgtcagaag
aggatgcagaaggagcaggagcagaacggagacagcaacgtgcggtctgatgagccgctt
caaaagaagaaggataaggagcgggaacgagagctgaaggcaaagggcctaaatggcgaa
gcggagctggctgccgagaagaagactgcgggtgaagacactgccatgggcggcacggag
gagaagttcaagaccgatgaggagatcgaggctgagcgtgccgcttccatcctcgccgcg
aagaaggacctcctctcgcttgtgcatcctgacatggccaaggattccaccgccaaccag
acaggtctgtacgaactccgagctctggtcacgcatcagggttcttcggccgactccggt
cactacactgcctatgtgaagaaggctgccccggcgcctggcaaagaggaagatggcaag
tggtggtggttcaacgacgacaaggtgcaggaggtggagagcgagaagattgaaacattg
tccggtggtggagagactcacagtgcgctgatcttgctctaccgggctgtgcccttgccg
accatcacagaggccgagcagaaggcggcatag

DBGET integrated database retrieval system