KEGG   Zymoseptoria tritici: MYCGRDRAFT_66426Help
Entry
MYCGRDRAFT_66426  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ztr  Zymoseptoria tritici
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MYCGRDRAFT_66426
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     MYCGRDRAFT_66426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 517 aa AA seqDB search
MHNHVHNPFDDPAGSDTSLESTEAVLTVGRNATLTLATDALIVLDEGLRHRRAASNCCGL
LPQLSKTTRAIPFHNVLWAELNDFDVNVHYTQTVGRKSKGCRVALITYNVTDKSTHAHAK
RWVENLLARAYPPNTQRRKRVKVLINPFGGQGYAEKSWRKEIEPIFAAANCVVDVERTQY
RGHAVEIAQNLDIDAYDVVACASGDGLPHEVFNGLAKHKTPKLALRKIAVVQLPCGTGNA
MSLNLSGTDSPSLASLEIVKGTRTPLDLVAITQGDKTYYSFLSQAVGIIAESDLGTDNLR
WMGSFRFTWGILVRLLGKTIYPAEVSLVVDSDDKRLIKETYRQVAEEHEAARAKHLCRAT
YEDDLPQGDNAQLPELRFGTVTDPLPSNFATRDIANLGNFYVGNMCYMSGDAPFFTATLP
SDGKMDMVIAPGDMARMTAIRMLTTVEQGTLINFPEISYSKVLAYRITPRMAPKEGLISI
DGEQVPFEPFQGEVVPKLGTVLSKSGAIYEIGGLAPL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaccacgttcacaatccattcgatgacccggctggctccgacacatcgctcgag
agcaccgaagctgtcctgaccgtcggccggaacgctacacttacactggcaacagacgct
ctgatcgtgctggatgagggtctacgccatcgaagagctgcctcgaattgctgcggtctg
ctgccacaattgtcgaaaaccacgcgagcgatacctttccacaatgtcctctgggcagaa
ttgaacgacttcgatgtgaatgtgcattacactcagactgtgggtcgcaaaagcaaaggg
tgtagggtcgccctcatcacatacaatgtcacggataagagcacgcatgcgcacgcgaaa
cggtgggtagagaatctgctggctcgggcatatcctccgaatacgcagaggcgaaagcga
gttaaagtgttgatcaacccgttcggtgggcaaggatacgcggagaagtcgtggaggaag
gagatagagcccatctttgccgctgcgaattgtgttgtggacgtggagaggacgcaatac
agaggccatgctgtcgaaatcgcacagaatctggatatcgatgcgtacgatgtggtagcc
tgcgcttcgggtgatgggctgccccatgaagtgttcaacggactggcaaagcacaagaca
ccgaagcttgcactccgcaagatagcagtcgtccagctgccatgcgggactggaaatgct
atgagcttgaatctgagtggcacagactcgccatcgcttgcttctctggagattgtcaaa
ggaacgaggacaccgcttgatctggttgccatcacccaaggtgacaagacgtactacagc
ttcctctcccaagccgtgggcatcatcgccgagtccgatctcggaactgacaacttgcga
tggatgggatcgttccgcttcacctggggcattctcgtgcgactgctcgggaagacgatt
tatccggcggaggtttcactggtggtggactcggacgacaaaagactgatcaaggagacg
taccgacaggtggccgaggagcatgaagctgctagagcgaagcacttatgtcgtgcgacg
tatgaggatgatctaccccagggcgacaacgcacaactccccgagttacgattcggcacg
gtcacggatcctctcccatcgaactttgcaactcgagacattgcaaatctgggcaacttt
tacgtcggaaatatgtgttacatgtcgggggacgcaccttttttcaccgcaacattgccc
tctgatggcaagatggacatggtcatcgcgccgggcgatatggcccgaatgacagctatt
cgaatgctcacgacggtcgagcaaggcactctcatcaactttccggaaatttcgtactcg
aaagtcctggcctaccgcatcacaccgcgcatggcacccaaggaaggattgatatctatt
gacggcgagcaagtcccgtttgaacccttccagggggaagttgttcccaaacttggaaca
gtactctcgaagagcggtgcgatttatgaaattggtggtctggctccgctgtag

DBGET integrated database retrieval system