KEGG   Zymoseptoria tritici: MYCGRDRAFT_66866Help
Entry
MYCGRDRAFT_66866  CDS       T02285                                 

Gene name
MgPME1
Definition
putative pectin methylesterase/Pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ztr  Zymoseptoria tritici
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MYCGRDRAFT_66866 (MgPME1)
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_66866 (MgPME1)
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     MYCGRDRAFT_66866 (MgPME1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 330 aa AA seqDB search
MRYINILAGFVGLVLAAGRTSPPEGALVVAADGSGKYKTIQDAVNALSSSSSEQSIFIKP
GTYKEQVYVKQLNGPLVIYGHTSDTSSYAGNQVVITGSKSQKTEANNDATATLRVWTSNF
KLYNVNVVNTFGKGSQALALSANAGDQGYYGCSFKGFQDTVLAQTGAQLYAKSYIEGATD
FIFGQNGQAWFDYCDIRVLSASVGYITASGRADAANPSHYVLNKCSISAAGGKSVEAGAY
FLGRPWGAYARVAVQSCTMSNVINAAGWAVWNKGDERTGKVEFGEYGNEGAGASGTRAKF
AKKLDAPVKKESVLGSGYASASWVDKAYLS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacatcaacatcctcgccggctttgtgggcctcgtgctcgcggcaggtcgaacc
agtcctccagaaggtgctcttgtcgtcgccgcggacggcagcggtaaatacaagacgatc
caggacgcagtcaatgcactctcgtcgtcctcttcggagcaaagcattttcatcaagccc
ggcacctacaaggagcaggtatacgtgaagcagctcaatggacctctcgtcatctacggc
cacacatcggacacgtcttcatacgccggcaaccaagtcgtcattactggcagcaagagc
cagaaaactgaggccaacaacgatgcgaccgccaccctccgagtctggaccagtaacttc
aagctttacaacgtcaatgtcgtgaacacttttgggaagggcagccaagccctggctctc
tccgccaatgccggcgaccaagggtactacggatgctccttcaaaggcttccaagacacc
gtcctcgcgcagactggcgctcagctctacgccaagagctacatcgaaggcgccacggac
ttcatcttcggccagaacggtcaagcttggttcgattactgcgacattcgtgtattgtca
gcctctgtgggttacatcaccgcctctggccgcgccgacgccgcgaatccgagtcactat
gtcctcaacaagtgcagcatctctgctgcaggaggcaagtccgtagaggccggagcatat
ttccttggacggccgtggggagcgtacgcccgcgtagcagtccagtcctgcacaatgtcg
aatgtcatcaacgcggcgggctgggcggtgtggaacaagggcgacgagaggacgggaaag
gtcgaattcggcgaatatggtaatgagggtgctggcgcttcgggcacgagggcgaaattc
gcgaagaaattggatgcgcctgtcaagaaggagagtgtgctggggagtgggtatgcgagt
gccagctgggttgacaaggcatacttgtcgtag

DBGET integrated database retrieval system