KEGG   Zymoseptoria tritici: MYCGRDRAFT_67691Help
Entry
MYCGRDRAFT_67691  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MYCGRDRAFT_67691
Peptidases [BR:ztr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MYCGRDRAFT_67691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 576 aa AA seqDB search
MPERPLTIATYAAGASLAAVTLVYVFGPTFFLDDEASNSSRATRKKGVVGLANPANDCFI
NSVLQALAGLPELRAYLIREVHRRSLDGPELYLDLTAAEEEAQKNRKSREIPDWKVVGQQ
QGLVTNALKEVLDALNERPIYKKTISAQGFIRAVEGAFRTRISRSQQDAQEFLQVVVERL
AEEHAAGRRVRRKARQVAAEEEGDVPHSNGDTEGPSKEEDDSDDSETVNPLEGKLESQVE
CSHCQFKPKPSISSFLTLTLNVPHDSTSSTLAVCFDQLLKVEHIDDFKCDRCRLDFALQQ
LSQTLSRPSLTPSERALHLKHQSLIQQAIATDPEKPPKDVPLPSLSATPNRRIAKHVRIS
AFPKILTLHLSRSVWDPSSASSKNSAKVPFPETLPLGGLLQRKTYRLLGVVTHKGGHNSG
HYESFRRQHLPKPYSTKVSLGTEGIYSRKNSPVPSPRGSAGNSPRLGGTSESAETGRGGR
GEGSDAEESTDLTELSTGTSTSSSSEPEGEGDGAAPPVKRRNSMRDALRRKGKGSNGGYG
SERWWRISDEKVKECKTGDVLGMQREVYLLFYERVE
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcggcccttgaccatcgcaacctacgcagccggcgcatccctcgcagcagtc
accctcgtctacgttttcggaccgacctttttcctcgacgacgaagcctcaaatagttcc
cgcgcgacccgtaagaagggcgtcgtcggactcgccaaccccgcaaacgactgcttcata
aacagcgtgctgcaagctctcgccggtctgcctgaactacgagcctacctaatccgagag
gtacatcgaagatcactggatgggccggaattgtacctggacctgacggccgcggaggag
gaggcacagaagaatcggaagagtcgagagatcccagattggaaagtggtcggacaacag
cagggtttggtgacgaatgcgctgaaggaagtgctggatgcgttgaacgaacggccgatt
tataagaagacgatctcagcgcaggggtttattcgggcggtggagggggcgtttcgcacg
aggatttcgcggtcgcaacaggatgcgcaggagtttttgcaggttgttgtggagaggttg
gcggaggaacatgctgctgggaggagggtgaggaggaaagctagacaggtggcagcggaa
gaggagggggatgtgccacacagtaatggagacacagagggaccttcgaaggaggaggac
gacagcgacgactcggagacggtgaacccactggaaggcaagctggaatctcaagtcgaa
tgctcgcattgccaattcaaaccgaaaccctcgatatcctcattcctgacattaaccctc
aacgtccctcacgactccacctccagcactctagccgtctgcttcgaccaactcctcaaa
gtcgaacacatcgacgacttcaaatgcgatcgctgtcgcctcgacttcgccctccaacaa
ctctcccaaaccctctcccgaccttccctcaccccatccgaacgcgccctccacctcaaa
caccaatccctcatccaacaagccatcgccacagacccggagaaacccccaaaagacgtc
cccctcccctccctctccgcgaccccaaaccgccgaatcgccaaacacgtccgcatctcc
gccttccccaaaatcctcaccctccacctctcccgctccgtctgggatccttcctctgca
tcttccaaaaactcggccaaagtcccattcccggaaaccctcccgctcggcggcctcctc
caacgaaaaacctaccgtctcctcggcgtcgtcacacataaaggcgggcataattccggt
cactatgagagttttcgacgacaacatttaccgaagccgtactcgacgaaagtcagtctc
ggcacggaggggatttatagtcgtaagaattctccggtgccgagtccgagagggagtgcg
gggaatagtccgagattgggtgggacgtcggagagtgcggagacgggacggggtgggagg
ggggaggggagtgatgcggaagagtcgactgatttgacggagttgtcgaccgggacctcg
acttcctcttcgtcggagccggagggcgagggagacggtgcggcaccaccggtgaagagg
cgcaactcgatgcgggacgcactacggaggaagggaaagggttcaaatggtgggtatggg
agtgagagatggtggaggatttcggatgaaaaggtcaaggagtgtaagacgggggatgtg
ctggggatgcagagggaggtttatttgttgttttatgagagggttgaatga

DBGET integrated database retrieval system