KEGG   Zymoseptoria tritici: MYCGRDRAFT_67795Help
Entry
MYCGRDRAFT_67795  CDS       T02285                                 

Gene name
TOR1
Definition
TOR1 phosphatidylinositol 3-kinase
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ztr  Zymoseptoria tritici
Brite
Protein kinases [BR:ztr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   MYCGRDRAFT_67795 (TOR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 2427 aa AA seqDB search
MASVYKEPLDAIFTDLKARGELTRQNAAARLLDNVNTAYRELAQGPFQTYYADVNSRMVN
MILGGNDTHERTGGLYALNALIDFKGDDAAQKVPKFSNYIKRTLEGNDTSAMVVAAKCLG
RLATPGGALTAELVEAEVKRALEWLTSERAENRRFAAVLILRELARNSSTLLYMYIPGIL
ASIWEGLRDQKVVIRETAAEVVSQCFKILSARDPQQRSTCLTRMFEGAQDGFRRGTVECI
HGSLLVYKELLIQGGMFMHGSKYKEASDRVLLQQYREHRDPTIRRTVVEIIPLIAAYAPK
DFCNHYLARSMQHLQTLLKDPKQRNMAFVAIGKVAHAVTSAIAPYLDTILLHIRDALSLK
NRTKHSDEAPIFECISMMAIAVGQTLSKYMEALLDPIFACGLSDSLTQALVDMAHYIPPV
KSTIQEKLLDLLSRTLCGQPFQTLGHPTQGKGLPPIYTRDYRDQRDPQHLEHKDQEIALA
LVTLGSFDFSGHVLNEFVRDVAIRYVEDDDATIRKAAALTCCQLFVKDPIVHQTSHHAIQ
VVSDVIEKLLTVGVADPQPDIRQTVLVSLDARFDRHLAKAENVRTLFLALNDEKFPIREA
AMTIIGRLTSVNPAYVFPSLRKVLIQLLTEIEYSNSSNNKRESAQLISHLVGASSKLIKP
YVDPMVTVLLPKAEDSNADVAATTLRALGDLATVGGDDMVKYIPDLMRIIIRSLQDLASP
KKREAALCTLGQLASNSGYVIDPYTDHPELLTILVSIVKNEAPGDLRRETIRLMGILGAL
DPYKHQQVIEESPESNLRAEAEAESDVTLIMKGITPSNEDYYPTVVINTLMSMLKEDTLK
QYHSSVVEAVMNIYATMGMKCVPFLSTVVPGIVGVLKDATSDNRLEGYFNQLSLLVKIVR
QHIRPHLSVILEAISDHWYKSTQLQATILTLIESIARSLEGEFKVYLANVLPLMLGVLDA
DNRTESGRAACQRVLHAFLVFGASAEEYMHLIIPVIVRMFDTADGRYRHRDVRKSAIETI
GRLSRQVNISEFSAKIIHPLSRVLQGNDNNLKTPAMETLCALIFQLGQDYMHFIPTIEKI
LVQQKVHHTHYNIIIGKLKKHEALPQDLSPEEKYHDEDEDTYPTEISTKKLAVNQQHLKN
AWEANQKSTREDWQEWMRRFSVELLRESPQQALRACTNLAGIYAPLARSLFNSAFVSCWT
ELYDQYQEELVRSIEVALTSPNIPPEILQILLNLAEFMEHDDKALPIDVRTLGMYAGKCH
AFAKALHYKELEFNAEQNASAVEALISINNQLQQTDAAFGILRKAQGYQDVDLKETWFEK
LQRWEEALLAYQAREEAEGGPEKASFEVVMGKMRCLHALGEWDTLSSIAQDKWMHASGEN
KRHIAPLAAAAAWGMGQWDIMDDYLSAMKQHTPDRSFFGAILAIHRNHFEEAHAHITKAR
DGLDTELSALLGESYTRAYSVIVRVQMLAELEEIITYKQHANDPDKRERMRATWTKRLKG
CQRQVEVWQRMLKVRALVITPQENTEMYIKFASICRKAQRGGLAEKSLNSLLGSTGPIGN
LLSDSESWSKVKNADYPVQYATFKFLWSNDQHDAALAALKDFTTRLRNDYEESNTAALSI
AGASANGGGLLNGANGVNGIHSTGPFGAANAQHISPRDKAELEEWKTLLARCYLKQGDWQ
VKLHNGDWQSEHVQDVLQSYYSATRYNENWYKAWHAWALANFEVVTSLTAGDRESADVPH
YIVSEHVVPAIKGFFKSIALSSSSSLQDTLRLLTMWFAHGSHQEVTHSVQQGISSVSVDT
WLEVIPQLIARINQPNRLVREGIHNLLVEIGRAHPQALVYPLTVSMKSDMGNRSRSAGRI
MEAMKQHSPKLVEQAGLVSHELIRIAVLWHEQWHEGLEEASRLYFGDHNIQGMLATLEPL
HEMLRKGPETLREISFIQSFGRDLNEAHDWCEAYKSTKEIGDLNQAWDLYYGVFKRIARQ
LPQLMSLELQYVSPELKNAHDLDLAVPGTYISGKPIIRIKSFDPVATVISSKQRPRKLGL
RGSDGNKHDFLIKGHEDIRQDERVMQLFGLVNTLLSTDPECLKRHLNIQRYAAIPLSTQA
GLIGWVPNSDTLHVLIREYRESRKILLNIEHRIMLQMAPDYDNLTLMQKVEVFGYALDNT
TGQDLYRVLWLKSKSSEAWLDRRTNYTRSLGVMSMVGYILGLGDRHPSNLMLDRVTGKIV
HIDFGDCFEVAMHREKYPERVPFRLTRMLTFAMEVSNIEGSYRTTCEHVMRLLRGNKESL
MAVLEAFIHDPLLTWRLGTRESPPEPSFPSERRTSIMGAPMPTEAAGGRRTSVMGGDPNA
PQGDRPNNSFRPRNRSIVQPNGIDPADREVQNVRALQVLARVKEKLTGRDFKKETELNVT
EQVERLLSEATNLENLCQHYIGWCSFW
NT seq 7284 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgtttacaaggaaccgctcgatgcgatattcacagacctcaaagctcgcggc
gagctcacccgtcagaatgccgccgcacgtctgctggacaacgtcaacacggcctatcgc
gaactggctcagggcccgttccaaacctactacgccgatgtgaacagccggatggtgaac
atgattctcggaggaaatgatacacacgagcggacaggcggtctatatgcgctcaatgct
ctcatcgacttcaagggcgacgatgccgcgcaaaaggtgcccaagttcagcaactatatc
aaacggacactcgagggaaatgacacaagcgccatggtcgtcgcagccaagtgtctgggt
cgccttgccacccctggaggagctttgaccgcagaactcgtcgaggcggaagtgaagcgc
gcgctggagtggctcacatctgagagggcggagaaccgccgatttgctgcagtgctcata
ctgcgcgaactggcgagaaatagctctacgcttctgtacatgtacattccaggaatactg
gccagcatctgggaaggcttgcgcgatcaaaaggtcgtgatccgagaaacagccgcagag
gttgtctcacaatgcttcaagattctgtcagcgcgagatccgcagcagcgctccacatgt
ctcacgcgcatgttcgagggtgctcaagatgggttccggcgaggtactgtcgagtgtatt
cacgggtctctgctagtatacaaggaactcctgattcagggcggcatgttcatgcatgga
tccaagtacaaggaggcctctgacagggtattgttgcagcaatatcgcgagcatagggat
ccaacgatcaggagaaccgttgtcgagatcatccctctgatcgctgcttatgctcccaaa
gacttctgcaaccactacctcgcccgctcaatgcagcacctgcaaactctcctgaaggat
ccgaagcaaaggaacatggcgtttgttgccattggcaaagtcgcacatgccgtgacctcg
gcgatagcgccctatctcgacaccattctgcttcatatccgtgatgcgttgtcactgaag
aaccgcacaaagcactccgacgaggcacccatcttcgagtgcatcagcatgatggccatc
gccgtcggtcagaccctcagcaagtacatggaggcccttcttgatcccattttcgcttgc
ggtctgtccgactctctaacgcaagccttggtcgacatggctcattacataccaccggtc
aagtccacgatccaagagaagctgctcgacttgctcagtcgcacgctctgcggtcagccg
ttccagactcttggccatccaacgcaagggaagggacttcctccaatctacaccagagac
tatcgcgatcaacgagatccacaacacctggagcacaaggaccaagagattgctttggct
ttggttacgctgggctcgttcgacttcagtggtcatgtcctcaacgagttcgtgcgcgat
gtggccattcgatacgtcgaagatgatgacgccacgatccgtaaagcagcagcattgacc
tgctgtcaactgtttgtcaaagacccaatcgtacatcaaaccagtcatcacgccattcaa
gtggtctccgatgtcatcgagaagctcctcacagtgggtgtggctgacccgcagccggat
attcgtcagacggtcctggtctctctggatgctcgattcgatcgccatctcgcgaaggcc
gaaaacgtgcgcacgctgttcctcgcgctgaacgacgagaagttccccatccgtgaggcg
gcgatgaccatcatcggtcgtttgacatcggtcaacccggcttacgtcttcccatcgcta
cggaaagttctgatccagctactgacggagattgagtactccaacagctcgaataacaaa
cgagaatcagctcagctgattagccacctcgtcggcgcaagcagcaagctgatcaagcca
tacgtcgatcccatggtcaccgtgcttttgcccaaagcggaggattcgaatgcagacgtg
gcggctacaaccctgcgcgctcttggtgatttggctactgttggcggagatgacatggtc
aagtacattccagatctcatgcggatcatcattcgaagccttcaagacctcgcatctccc
aagaaacgcgaagctgcgctgtgcacactaggtcagcttgcaagcaatagtggctatgtc
atcgacccatacaccgaccacccagagttgttgacaatcctggtcagcatcgtcaaaaat
gaagctcctggcgatctccgtcgtgagacgatccgcctcatgggcatcctgggtgcgctt
gacccatacaagcatcagcaggtgatcgaagagtccccggagtccaacctccgtgccgaa
gcagaggcggagtcggatgtcacactcatcatgaagggcatcacacccagcaacgaagac
tactacccgactgtggtgatcaacacgctcatgagcatgcttaaagaagacacactcaag
caataccattccagtgtagtcgaagcagtcatgaacatctatgcaacaatgggcatgaaa
tgcgtcccatttctgagcactgttgtgcctggtattgtcggtgtgttgaaagatgcgaca
tcagacaaccgactcgaaggctacttcaatcaactcagcttgttggtcaagattgtgaga
caacacatccgcccacatctcagcgttatcctcgaggccatcagcgatcattggtacaag
agcactcagttgcaggccactattctcacactcatcgaaagcatagcgaggagcctcgaa
ggcgagttcaaggtgtatctggccaacgtcctcccactgatgcttggtgtacttgacgcg
gacaaccggaccgagagtggtcgggctgcctgccaacgcgtactccacgcattcctcgtc
ttcggagccagcgcggaagagtacatgcatctcatcattccggtcatcgtgcgaatgttt
gacactgcagacggaagatatcgtcaccgcgacgtccggaagtcggccatcgagaccatt
ggacgtctgagcaggcaagtcaacatctccgaattctccgcgaagatcattcatccacta
tcgcgggtgttgcaaggcaatgacaacaacctcaaaacaccggcgatggagactctgtgt
gcgctgatctttcagctgggccaagactacatgcacttcattcctaccattgaaaaaatc
ctcgtgcagcagaaggttcaccacacccactacaatatcatcatcggcaagctgaagaag
cacgaagctctgccgcaggatctcagtccagaggagaaatatcacgacgaggatgaggat
acctaccccactgagatctccacgaagaagcttgctgtcaaccagcagcatttgaagaac
gcatgggaggccaatcagaaatccaccagagaggactggcaagaatggatgcgtcgcttc
tcggttgagttgttgcgagagtcaccgcaacaggcgctaagagcgtgcactaacttggcg
ggcatctacgcacccctcgcgcgcagtctcttcaacagtgcctttgtgagctgctggacc
gagctctacgatcaatatcaagaagagctcgttcgttccatcgaagtggcgttgacaagt
ccaaatattcctcccgaaatcctccagatcctgctcaacctggccgaattcatggaacac
gacgacaaagccctccctatcgacgttcgcacactgggtatgtacgctggtaaatgtcac
gcattcgccaaggcactgcattacaaggagctcgagttcaacgccgagcagaatgcaagt
gcggtggaggctttgatttcgatcaataaccagctccagcagaccgacgcagcctttggt
atccttagaaaggctcaagggtatcaagatgtggatctgaaggagacatggttcgaaaag
ctccaacgctgggaggaggctcttctcgcatatcaagcacgcgaggaggctgaaggtggc
ccagagaaagcatctttcgaagtcgtcatgggcaagatgcgatgtttgcatgctcttggt
gagtgggacactctgtcctcgatcgcgcaagacaaatggatgcatgcctctggagagaat
aagaggcacattgctccattagcggcggccgcagcatggggtatgggccagtgggacatt
atggacgactatctgagcgccatgaaacagcatacgcctgatcgcagtttcttcggcgcc
atcttggccattcaccggaaccactttgaagaggctcacgctcacatcaccaaggcgaga
gatggtctcgatactgagttaagtgcactgctcggcgagagctatacccgtgcatacagt
gtgattgtcagggtccaaatgctcgcagaactggaagagatcatcacctacaagcaacac
gcgaacgatccagacaagcgggagcgaatgcgcgcaacctggacgaaacgtctgaaaggc
tgtcaacgtcaagtagaagtatggcagcggatgctcaaagttcgcgctttggtcatcacc
ccacaggagaataccgagatgtacatcaagttcgcctccatttgccgcaaggcacaacga
ggcggtttggcagagaagagtctcaacagccttttgggcagtacgggtccgattggaaac
ctgctatctgactcggaaagctggtcgaaggtcaaaaacgcagattacccggtgcaatac
gctacattcaagttcttgtggagcaatgatcagcacgatgctgcgctagccgcattgaag
gacttcacgacccggcttcgcaacgattacgaggagagcaacactgctgcgctgtcaatc
gcaggcgcttctgccaatggcggagggttgttgaatggcgccaatggtgtcaatggtatc
cacagcactggaccttttggcgcggctaacgcgcagcacatctcaccgagagacaaagca
gaacttgaggagtggaagacattgcttgcgcgctgttatctcaagcaaggcgactggcag
gtcaaattgcacaacggtgactggcaatcggaacacgttcaggacgttcttcaatcctac
tactctgcgacgagatacaacgagaactggtacaaagcctggcacgcctgggcgctggcg
aactttgaggtcgtaacttccttgactgctggtgaccgtgagtctgccgatgtgccccac
tacatcgtgtcagagcatgtggtcccggctatcaaaggattcttcaagagtattgcgctc
tcgtcgtccagctcgctgcaagacacgctccgccttctaacgatgtggttcgcacacggc
tcacatcaagaagtcactcacagtgtgcaacaaggcatctcttctgtcagcgtggacacg
tggctggaggtcatcccccagctcatcgcacgaattaatcaacccaacaggttggtccgc
gaaggaatccacaatctattggtcgagattggcagggcacatcctcaggccttggtgtac
cctctgaccgtcagcatgaagagcgacatgggcaatcgatcgcgctctgcaggcagaatc
atggaggcaatgaagcagcactcccccaagctggtggaacaggcgggacttgtcagccac
gagctcattcgcatcgcggtgctctggcatgagcaatggcacgaaggtttggaagaagcc
agtcgtctctactttggcgatcacaacattcaaggtatgctggcgacgctcgagccacta
catgaaatgctccgcaagggcccggagactctccgagaaatatccttcattcaatccttt
ggtcgcgaccttaatgaagcgcacgactggtgtgaagcgtacaagtcgacgaaggagatt
ggtgatctcaaccaggcgtgggatctttactacggcgtcttcaagagaatcgctcgccaa
ctgccgcagctcatgagtctggaactacagtacgtttctccagagctgaagaatgcccat
gatctggacctcgcggtgcctgggacatatatcagtggcaagcccatcatccggatcaag
agcttcgatcccgtggcgaccgtcatttcgtccaagcagcgaccacgaaagctcggactt
cgaggtagtgacggtaacaagcacgatttcctcatcaaggggcacgaagatattcgacag
gatgagagagtcatgcagcttttcggtctcgtcaacacacttttgagcacggatccggaa
tgtctgaagcgccacttgaacattcagcgctatgccgccatccctctctcaacacaagct
ggtctcatcggctgggttcccaactcggacacgttgcacgttctgattcgcgaataccgc
gagagccgcaagatcctcctcaacatcgagcatcgcatcatgctgcagatggcgcccgat
tacgacaatcttacactgatgcaaaaggttgaagtcttcggctacgctttggacaacacc
acaggacaagatctgtaccgagtcttgtggctcaagagcaagtcttccgaggcctggctc
gatcgacgaaccaactatactcgctcgttgggtgtcatgtctatggtcggatacattctc
ggacttggcgatcggcatcccagcaatctgatgctcgatcgtgtcactggtaaaatcgtg
catatcgacttcggagactgtttcgaggtcgcaatgcatcgtgagaagtaccccgaacgc
gtgccattccgactgacgaggatgttgacatttgccatggaagtgagcaacattgaggga
tcctaccgcaccacctgtgagcatgtcatgcgactgctccgcggtaataaggaatctctg
atggctgtgctggaagctttcattcacgatccgctcttgacctggcgtctcggcacacgc
gagtcccctcctgaaccatccttcccatcggagcgacgcacatcaatcatgggtgctccg
atgcccacggaagcagctggcggtcgccgcacttctgtcatgggtggtgatccaaatgcg
cctcaaggtgacaggcccaacaattctttccgaccgcgcaacagaagcattgtgcaaccc
aacggaatcgatcccgcggatagggaggttcaaaatgtccgtgccttgcaagtgcttgcc
cgcgtgaaggagaagttgacgggacgcgacttcaagaaggagaccgagttgaacgttacg
gaacaggtcgagcgtctgctcagcgaggcgacgaatctggaaaacctctgccagcattac
ataggatggtgcagcttttggtga

DBGET integrated database retrieval system