KEGG   Zymoseptoria tritici: MYCGRDRAFT_67924Help
Entry
MYCGRDRAFT_67924  CDS       T02285                                 

Gene name
YAK1
Definition
serine/threonine protein kinase
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     MYCGRDRAFT_67924 (YAK1)
Protein kinases [BR:ztr01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   MYCGRDRAFT_67924 (YAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 883 aa AA seqDB search
MSLSTPTADTGASAASSPRRARSNMDGYGNGSDMDVDMDADPFNQQKYARPPSNSRPASQ
HYLPTHSQTAGGDAAAARTARYSPMNMSPPTYASPAQQQQQQTPSNQYASYTPQQAARLS
PSRQQFSSPSQQRYYASPPGSARAHTSQLPPLQAAASPNAYYPQSATQQLNAVFGHEQEP
QKRDPQQRQGSGSSDPVPQFSKVNGLGDLASNINSQPPFRRANPEGGFISPLQALTTHLP
ATYRICNPGFQYESSRNPRRVLTKPSKGVKNDGYDNEDSDYILYVNDILGSEETNHKNRY
LILDVLGQGTFGQVVKCQNLKTQEVVAVKVVKNKTAYFNQSMMEVSVLDLLNGRMDKNDD
HHILRLKDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLNGLCLLSK
AKLIHCDMKPENILLKNLESPIIKIIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYSA
AIDMWSLGCIVVELFLGLPLFPGSSEYNQVSRITEMLGLPPNWMLETGKQSGEFFEKVHD
EFGRRTYRLKSMEQYAREHGTKEQPSKKYFQQTRLPDIIRAYPMPRKGMKPNEMEREMAN
REAFIDFVHGLLNINPLERWSPQQARTHPFITQQKFTGPFQPQMNLKSTSRSPAPGVQQQ
QQAEALSKQRAQQAQAAQVQQAASAQAYASMQPSMHMNSGYPPSPHSAQQQHQQAAMYQN
MYSPSHQGAPPPYPANPPQQSSAYGQQLPMIQQPPPTASMNPYAPQQQSQQPSQQQNLYA
QATTRGARQRATTMDGNGIPAALQRVAGHLDPNAPIRLQPSPAYYPPPQDGQADAGNIGG
RRRTSRATGSQDRNFVRMLEDRTLEEGWNGGGGGGGGNGWPGS
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgtcgaccccgactgccgacactggcgcttccgctgcttcctccccacggcgt
gcgcgcagcaacatggacggatacggcaatggcagtgacatggacgtcgatatggacgcc
gatccgttcaaccagcagaaatacgcccgcccgccgtccaattcccgtccggcttcccaa
cactacctgcccactcattcgcaaaccgccggtggtgatgccgccgctgcacgcaccgca
cgatactctcccatgaatatgtcgccgcctacatacgcgtcgcccgctcagcaacagcag
cagcaaacaccttcgaatcaatacgcttcatacacaccgcagcaggcggcacgattgtct
cccagccggcaacaattctcttcgcccagccagcaaagatactatgcctctccaccgggc
tctgctcgcgcacatacctcacaactacctcctttgcaggccgccgcatcacccaatgcg
tattatccgcagtctgccacccagcaactcaacgctgtctttgggcatgaacaagagccg
cagaagcgagatccgcagcaacggcagggctctggctcctccgatcctgtcccgcagttc
tcgaaagtgaacgggctcggtgatctcgcctccaacatcaattcacaacctcccttccga
cgagcgaatcccgaaggcggcttcatcagtccattgcaagcactgaccacgcatctgccg
gccacgtaccgcatctgcaatcctggctttcaatacgaatcatcacggaatccgcgacga
gtgctcaccaagccgagtaaaggcgtgaagaatgatggctacgacaacgaggacagcgac
tacattttgtatgtcaacgatattctcgggtcagaagagacaaaccacaagaacagatat
ctcattctggatgtgctgggacagggaacgttcggacaggtggtgaagtgtcagaatttg
aagacgcaagaagtggtcgcggtgaaggtggtgaagaacaagacggcctacttcaaccag
tccatgatggaggtctcggtattggatctactgaacggaagaatggacaagaacgacgac
caccacattctaaggctcaaggacaccttcattcataggcagcatctatgtctggtgttc
gagctattgtcggtcaacctctacgagctaataaagcagaaccaattccgcgggttgagt
acgacgttggtgcgagtcttcgcgcagcagctgcttaatgggctttgtctactcagcaag
gcgaagttgattcattgcgatatgaagccggagaacattctgctcaagaaccttgaaagt
ccaatcatcaagatcatcgatttcggttcagcatgcgatgaacgacagacagtgtacacc
tacatccaatcccgattctaccgatcaccagaggtactcctcggactgccatactccgca
gcgatagacatgtggtcactcggctgtattgtggtggagctattccttggtctaccactg
tttcctggttcgtccgagtacaaccaagtatcgaggataacggaaatgctcggactaccg
ccaaactggatgctagagactggcaagcagtctggcgagtttttcgagaaggtccatgac
gaattcggacgaaggacgtatcgactgaaatcgatggagcagtacgcgagggagcatgga
acaaaggagcagccgagcaagaagtacttccagcagacgagacttccggacattatccga
gcgtatcccatgccgaggaagggcatgaagccgaacgagatggagagagaaatggccaac
cgcgaggcattcatcgatttcgttcacggacttctcaacatcaaccctctcgagcgctgg
tcgcctcaacaagcacgtactcatcctttcatcacacagcaaaagttcaccggacccttc
caaccacaaatgaacctcaaatctaccagtcgctcccctgctccaggcgtacagcagcag
cagcaagccgaagctctgtcgaagcagcgtgctcaacaagcacaagctgctcaagtccag
caagctgcttccgcacaagcctatgcatcaatgcaaccgagcatgcacatgaattcaggc
tacccacctagcccacactccgcccaacaacaacatcagcaagccgccatgtaccagaac
atgtattctccttcacatcagggcgcgccacctccatatcctgccaacccacctcagcaa
tcctccgcctatggtcaacaactcccgatgatccagcaaccgcctcctacggcttcgatg
aacccctacgctccacaacaacaatctcaacaaccctcccaacaacaaaatctctacgct
caggccacgacacgaggcgcccgccaacgcgccaccaccatggacggcaacggcattcct
gccgctttgcagcgcgtcgccggccatctcgatcccaacgccccgattcgtctgcagccc
agtccggcatactacccgcctccacaggacggacaggcggatgctggcaatatcggtggc
aggaggaggacgagtcgagccacggggagtcaagaccggaattttgtgaggatgttggag
gatcgtacgttggaggagggttggaatggtggtggtggaggaggtggtgggaatggatgg
cctggatcgtga

DBGET integrated database retrieval system