KEGG   Zymoseptoria tritici: MYCGRDRAFT_68349Help
Entry
MYCGRDRAFT_68349  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ztr  Zymoseptoria tritici
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MYCGRDRAFT_68349
Messenger RNA biogenesis [BR:ztr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     MYCGRDRAFT_68349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 1633 aa AA seqDB search
MAIDTALRGLQILQRDLIAFTEDRLPNVDRLRDQLDASTDLLKQLLERKRKNEASRSKLA
PTNDSQPSTITIDEAEYRIQPQFRESAIRVADELDLDEIEAARLCIESQLPGDHIADSLT
LRALIRFHQQRQALLDCVRIVLQVSVDNEGDGARAEALGSVAKVLIYGDGGNQTQGSAYW
RKCLEGMGDIESFLKKVAEYKDKIIMTGQSLSREMGEAVDAQRLLLTQQHESLAAIMCCM
VRGSYVQPEDYRSLLSKASPLETEADILVHYLPILISGAAYFASDHSTSADAARGLHALL
AAGPGQLQWKNSGFGAAAKVLWLAEYNARFSADSIDTGQSETERTRDEEARSKLFFDALG
DKAFHFILTASAHLRPIVWHDPAKKGIIEWLVEEAPGPSSNAPRASDDFATLVMRELQVF
TDAFVTNMPDMLRQLKSDEDEKRRNTLFQSANGDTRTEMDLERFMIIMAYAYQGDAEAAR
DFWADRESNLYGFLRWVSQRLPTPRVAAFCTLLKAIASDDNSANHAHRFLLEDVLMTSGK
LRKAYAVSWSQIFSEVELYASNVKDRSPAATEVISGGHDQVAAEQNLEEPETGIMLISYL
GLAAHIARTSSEARNWLLKDQPFHIGEVMCQLIRTVRLSGLRACCLDMLAALLTEKVLEV
RNGMWVLLDTWISSGGLEGHQSQRSHAQTQSPAKQYLQLFAASPDAASAFVQLLNGLLSP
VEDANEKAVDALPFPENLGAPLRHAGIETYVDFVLDTVFARSTVRMAAEGNVAMLDALRF
ECLQFTFQSLSTFNEDLVLLANTSNVAVESAMETKSLATYARLHPFARVMERLFEKGVVA
SLVATLQQPVESLDDAEPESPLVQATLKSIQVLNLAWKLQPTYLDIVRPIVSSHPSSRTQ
SSVGATLGSIDEHVEICLESLTLLQKIASSRKLCESPDPGAARSRRSNRILGILSPLATA
LSLQLRQDFVLDEWDLENGDMPLKLIKAKAVLDLLNASLDSSNDKPTVAHCLLGFSCFEK
VVDVLPGSPFDENDSLFHEIATCGATLPAIANAGNTSWLLSVKRGCLDILLKLAVSPLTA
HIIQPQLRAMDFLAALSRAQLPAATSPLWDGQLILDPDVLLDSSALAVRDFLHVRAAFFE
FAAASLRAAAEHNSFSVQEKIVSALLGTIKHPDGEQLPTISVFEMFDFFDLETAAAREAN
CKYLADVDLSICTKDDPETLISFDLKSAEDLLQLHKKALKVKGSIRESAELETVEFEIQA
ILASLLSQNNWRAVQSARLAALEAWTDLMSLMVTKGGLEQNDVIALSLQGLLVVLPKLEK
SLTDSLDAAGMLAKLTLTFTHAISPASRDPSPQTVSVAVERLLNTFRVSLKVITDGSTDL
ALRDVCYRTGCAVLASLPKASVGTGTSAFASAKQLLQLVQNSGERLLIVVTEDAFAGRGV
TRISALLFLDALIGLFQSLKVKSSILRALTKLNFVPVLIDGSIGSVAAAFNGEDELAAAL
AFFHTSLALLLRLCQTPEGTQLVLNSGLFQAIDDSHLFSTDPDVGMDVDNPQALKEFYAI
LADVLRIVTAAVVSKGPAPGKAFLQKYRSTVQALFKQASRGIGLDVAEELSRLLLSTDFL
EVCGSVRVYDVRC
NT seq 4902 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgacaccgccctacgaggattgcagatcctgcagcgagatctaatcgcgttt
accgaagaccgtctaccaaacgtggatcgtctcagagatcaattagacgctagcaccgat
cttttgaagcagcttttggaacgcaagagaaagaatgaggccagtcgaagcaaactggct
cctacgaacgattcgcagcccagtaccataacgatcgacgaagcggagtacagaatacaa
ccgcagttccgagagagcgcgatccgagtcgccgatgagctggatctagatgagatcgaa
gctgccaggctgtgcatcgaatcgcaacttcctggagaccacatagccgattcactcacc
ctccgcgcgctcatccggttccatcagcaacgacaagcacttttggattgtgttcggatt
gtgctgcaggtgagtgtggacaatgaaggagatggagcccgtgcagaagctctgggcagc
gttgcgaaggtgctcatatatggcgacggaggaaatcagacgcaaggctctgcgtattgg
cgcaagtgcttggagggaatgggcgacatcgagtcgtttctgaaaaaggtggccgaatac
aaagacaaaatcatcatgacggggcaaagtctgtcgagagagatgggtgaagcggtggac
gcccagcgacttctattgacacaacagcacgaatcgcttgctgcgatcatgtgctgcatg
gtcaggggaagctatgtgcagccggaggactaccgcagcctgctgagcaaagcttctcca
ctggaaaccgaagcagacatcctcgtccattaccttccaatcttgatcagtggcgctgct
tattttgcttcagaccattctacttccgcagatgccgcgcgcggattacacgcgttgctc
gccgccgggcctggccagctgcagtggaaaaattcaggatttggtgcggctgcaaaggtg
ttgtggctggcggaatacaacgctagattctccgccgattccatcgatacgggacagagc
gagacggaacgaacccgagatgaggaagctcgttccaaactgtttttcgacgcactcggg
gacaaggcctttcacttcatcttgacggcttctgcgcatttacgcccaattgtgtggcac
gatccagcaaaaaaaggcataatcgaatggctggtggaagaggctccaggtccttcatca
aacgctcctcgcgcttcagacgattttgcgacactggtgatgagagaacttcaagtattt
actgacgcattcgtcaccaacatgcctgatatgcttcgccaactcaaatcagatgaagac
gaaaagaggcggaatacgctcttccagtccgccaacggcgacactcgtaccgagatggat
ctcgagcgatttatgatcatcatggcgtatgcctaccagggcgatgctgaagccgctcgt
gacttctgggcggaccgcgagagcaatctgtatggatttctgaggtgggtgtcacagcgc
ctgcccacgcctcgggtcgccgccttttgcacgctgctcaaagctatcgcgtccgatgac
aactccgccaatcatgcccatcgtttcctgctggaggacgttctgatgacttcagggaag
cttcggaaagcgtacgccgtcagttggtcacagatattcagcgaggtcgagctgtacgcc
tcgaatgtgaaggacaggtctccagctgccaccgaagtcatatctggcgggcatgatcaa
gttgcagccgagcagaacttagaagaacccgagaccggaatcatgttgatatcatatctt
ggcctggctgctcacatagcccgtaccagctcggaggcaaggaactggctcctgaaggac
cagccattccatatcggcgaagtaatgtgtcagctcattcgtactgttcgattgagtggt
ctcagggcatgctgcctcgatatgctcgccgctctgctgacggagaaagttctcgaggtc
cgcaacggcatgtgggtactactcgacacctggatctcaagtggcgggttggagggtcac
caaagtcagcgatcacatgcccagacgcagtcacctgcaaagcagtacttgcagctcttc
gccgccagccctgatgccgcatcggctttcgttcagcttttgaacggcctgctctcacct
gtcgaggacgcgaacgaaaaggctgtcgacgcgcttcccttcccggaaaatctcggcgcg
cctcttcgacatgccgggatcgaaacctatgttgacttcgttttggacactgtattcgcg
cgcagtaccgtacgcatggctgccgaaggcaatgttgcaatgctcgatgcattgcggttc
gagtgccttcaattcactttccagtctctctccacattcaacgaggatcttgtccttttg
gccaacacctccaacgtggcagttgagtcagccatggagacaaagtcgcttgctacctac
gcccgattgcatccattcgctcgcgtgatggagcgtttatttgagaagggcgtcgtcgcc
tcacttgtcgccacgctacagcagccggtcgaatcgctggatgatgcagaacccgaatct
ccccttgtgcaggcgacactgaagagcatccaggtcttgaatcttgcgtggaagctacag
ccaacctacctagacattgtgcgacctatcgttagcagccacccgtcctctcgcacacaa
tctagcgtaggagcgacgctgggatctatcgacgagcacgttgagatttgtctggaatcc
ctcacactcctgcagaagatcgcgtcctcgcgcaagctctgcgaaagtccagatccaggc
gcagcacgatctcgtcggagcaatcgcatcttaggcattctttcccctctcgctacagct
ttaagtttgcaactgcggcaagactttgtgctcgatgagtgggacctcgaaaatggggac
atgccactgaagttgatcaaagccaaggcggtcctggacttgctcaatgccagccttgac
tcgtcaaacgacaaacccaccgtggctcactgcctgctgggcttcagctgctttgagaag
gtggtcgatgtgctcccaggaagtcctttcgatgagaacgactcactgttccacgaaatt
gctacgtgtggcgcaactctgcctgcaattgccaacgctggtaacacatcttggctgcta
tctgtcaaacgaggatgtttggacatccttctgaagcttgctgtttctcctctgactgca
cacattattcagccacaactccgcgcgatggacttcctcgccgctttgtcgcgtgcacaa
ctccctgccgcaacaagcccgctctgggatggtcaacttatactcgacccagatgttctt
cttgactcgtccgcgctggccgtgcgcgactttctccacgtgcgagctgcgttctttgaa
ttcgcagctgcgagtttgcgagctgcagcggaacacaattccttctctgtgcaggagaag
atagtcagcgctctgcttgggacaatcaagcatcccgacggcgagcagcttccaaccatt
tcggtcttcgagatgtttgatttcttcgatctggagaccgcggccgcgcgcgaggccaac
tgcaaatatctggccgatgtggacttgtccatttgcacaaaagatgacccggaaactctg
atctccttcgatctgaaaagtgctgaggatcttttgcaattacacaaaaaagctctcaaa
gtgaaaggcagtattcgggagtcggccgagcttgagacggtcgagtttgaaatccaggcc
atcctggcatcattgttgagtcaaaacaactggagagctgtgcaaagcgcccgactcgcc
gcgcttgaagcgtggactgatctgatgtctctcatggtcaccaaaggcggattggagcaa
aacgatgtcatcgcgctatcgctgcaaggcttgcttgtggtactgccaaagttagaaaag
tcactgacagacagtttggatgctgctggcatgctggcaaagctaactttgacctttaca
cacgcaatcagccctgcctcaagagatccatcgccgcagactgtcagtgtggccgttgag
cgtttactcaacaccttccgagtatccctcaaagtcatcactgatggcagcacggatctt
gcacttcgggacgtgtgctaccgcactggctgtgcagtccttgcctcccttccgaaagcg
tctgtcgggacgggcacctcagcctttgctagcgcaaagcagcttctacagctggttcag
aacagtggcgagcggttgctgatcgttgtgactgaagacgcgtttgctggtcgtggcgtt
acccgcatctctgccctgctcttcctcgacgcccttattggcctgttccagagcttgaaa
gtcaagtcttctattctccgcgctctgacgaagctcaactttgtgcctgtccttatcgac
ggcagcatcggaagtgtggcggcagcgttcaacggcgaagacgaacttgcagctgctctg
gcattcttccacacatctctcgcgcttttgctccgtctttgtcagacacccgaagggacg
cagctggttctgaactccggcttgtttcaggcaatcgatgacagtcatctgttcagcacg
gatcccgacgttggaatggatgttgataacccgcaggcattgaaggagttttacgccatt
ctcgcggatgtgttgaggattgtcaccgctgctgttgtgagcaagggcccagcacccggt
aaggccttcttacaaaagtatcgctctacagtccaggcgcttttcaagcaggcgtctaga
ggtattgggcttgatgtcgcggaggagctaagcaggctgctgctttccaccgattttctc
gaggtatgtggatctgtccgtgtctatgacgtgcgatgctaa

DBGET integrated database retrieval system