KEGG   Zymoseptoria tritici: MYCGRDRAFT_68731Help
Entry
MYCGRDRAFT_68731  CDS       T02285                                 

Gene name
CANB
Definition
(RefSeq) calcineurin regulatory beta sub-unit
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ztr  Zymoseptoria tritici
Brite
Protein phosphatases and associated proteins [BR:ztr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     MYCGRDRAFT_68731 (CANB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 ATP-cone
Motif
Other DBs
NCBI-GeneID: 13400967
NCBI-ProteinID: XP_003855060
JGI: Mycgr3_68731
UniProt: F9X3U4
Position
2
AA seq 174 aa AA seqDB search
MGNANSAMLDNIVNGTNFDREEVDRLRKRFMKLDKDNSGTIERDEFLSLPQVSSNPLATR
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKVYDIDRDGYISNGELFIVLK
MMVGSNLKDQQLQQIVDKTIMEADLDHDGKISFEEFQKMVENTDVSMSMTLDQF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgcaaattcagcaatgctggacaacattgtcaatggcaccaacttcgaccgc
gaagaggtggaccgactacgcaaacgattcatgaagctcgacaaggacaactccggcacg
atcgagcgcgacgaattcctctccctcccacaagtctcctccaacccgctggccacacga
atgatagcaatcttcgacgaagacggtggtggcgacgtcgacttccaagagttcgtgtcc
ggcctcagcgccttcagctcgaagggaaataaagaggagaagctgcgctttgcgttcaaa
gtctacgatatcgatcgtgacggctacatcagcaacggcgagctctttattgtgctgaag
atgatggtgggcagcaatttgaaagatcagcagttgcagcagattgtggacaagacgatc
atggaagcggatctggaccatgatgggaagatcagcttcgaggagttccagaagatggtg
gagaacacggatgtttcgatgagcatgacgctggatcaattctag

DBGET integrated database retrieval system