KEGG   Zymoseptoria tritici: MYCGRDRAFT_69317Help
Entry
MYCGRDRAFT_69317  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ztr  Zymoseptoria tritici
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ztr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ztr03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 493 aa AA seqDB search
MSSPSATTALDYLESLPGLTFAKLYAQPSTALAVFRRMLPHLAKTVVMSMLYLPGPMRAA
DLEAWFKSDVQSSQERERSVSVLVRLKVLVEEQAGGGAGLQYRLSEAFAKGLRCALTGAV
GKGDAGKGSFGVACSAEKDEDVNVKFLDDFARRQWEAILYYVVGSANSGLSGDLEISAGT
KRLLQQGNFVQIKSGGKQRLITQAGFTFLLEEVNAQVWSLAVVYLRVCEDLQMDPVDVLS
FLFTLGSLELGIPYSTSNLTLTQQHMLDDLQDFGLIYRSSPTATAYYPTRLATTLTSDAP
ALPNNTSSTTTTAATESNEKGYIILETNYRLYAYTSSPLQISILSLFSTLHTRYPNLITA
KITKSSIASAISQSITSDQIITYLSTHAHPVLRRQAAIMSAPILPPTVVDQIRLWQIEGE
RMTTWKGFYIRDVGGWEEYVKAVEYAEALGVLRQRFDAKRSFFVGRMDQMAGYFKLAAER
RRRERDGGGGANV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctccgtccgccaccaccgcgctcgactacctggagtccctccctggcctcact
ttcgccaagctctacgctcagccgtccacagcccttgccgttttccgccgcatgctgcct
catcttgcgaaaaccgtggtcatgtccatgctgtacctcccaggaccaatgcgcgccgcc
gatctcgaagcatggttcaaatcagatgtgcagagcagtcaggaaagagaaagaagtgtg
agcgtactggtgcggctgaaagtactggtggaagaacaagcaggcggaggcgcgggattg
cagtacaggctcagcgaggcattcgcaaaaggactgcgatgtgcgctgacgggcgcggtt
ggaaagggagatgctgggaagggaagctttggagtggcctgcagtgctgagaaagatgag
gatgtgaatgtgaaattcctggatgacttcgcacggaggcaatgggaggcgatactatac
tacgtagtgggatctgcaaacagcgggctgtcaggagacctggaaatctctgccggtacg
aagcgactactacaacaaggcaactttgtccaaatcaagagcggcggcaagcaacgcctc
atcacccaagccggcttcacattcctgctagaagaagtaaatgcacaagtctggagtctc
gcagtggtctacctccgagtctgcgaggatctccaaatggaccccgtcgacgtcctctcc
ttcctcttcaccctcggctcactcgaactcggaataccttacagcacatcaaatctcact
ctaacccaacaacacatgctcgacgacctgcaagacttcggcctaatctaccgctcttcc
cccactgcaacagcctactaccccacacggctcgccacaacccttacatccgatgcgccc
gccctgccaaacaacacctccagtaccaccacaaccgcagccacagaatccaacgaaaaa
ggctacatcatcctcgagaccaactaccgcctctacgcctacacctcctcccccctccaa
atctccatcctttccctcttctcgaccctccacacccgctacccaaacctcatcaccgcc
aaaatcacaaaatcctccatcgcctccgccatctcgcagtccatcacctccgaccaaatc
atcacctacctctccacgcacgcgcacccggtgctccgccggcaagcagccatcatgtcc
gcgcctatactaccgcccacagtggtggaccaaatccgactatggcagattgaaggggag
aggatgacgacttggaaggggttttatattcgggatgtaggcgggtgggaggagtatgta
aaagcggtcgagtatgcggaggcattgggtgttttgcgacagcgatttgatgcgaagcgg
agtttctttgtgggcaggatggatcaaatggcgggttatttcaaactggcggctgagcgg
agacggcgggaacgagatggtggtggtggtgcgaatgtgtga

DBGET integrated database retrieval system