KEGG   Zymoseptoria tritici: MYCGRDRAFT_69648Help
Entry
MYCGRDRAFT_69648  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ztr  Zymoseptoria tritici
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MYCGRDRAFT_69648
Enzymes [BR:ztr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MYCGRDRAFT_69648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 161 aa AA seqDB search
MSTLSTTALGLALPREYGYVVTVTAATFFLGLWHGFRVSMARQPAGIKYPKAHADTADMS
SATPEQKQAMHIFNCAQRAHGNFLENHPGVAIAMLISGLKWPVVTAGLGATWVVGRIVYQ
IGYTSKTAENGKGRLPGYILGAIPQLALYVMAAWTGVSMVR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccctttccaccaccgccctaggcctcgccctcccacgcgaatacggctacgta
gtaaccgtcaccgccgcgaccttcttcctaggactatggcacggcttccgcgtcagcatg
gcccgccaacccgccggcatcaaataccccaaagcccacgccgacaccgccgacatgtcc
tccgcgacgcccgagcaaaagcaagcgatgcacattttcaactgcgcgcagcgagcgcat
gggaatttcttggagaatcatccgggtgtggcgattgccatgctcatctccgggttgaag
tggccggttgtgacggcgggattgggagcgacgtgggttgtggggagaattgtgtaccag
attggatatacgagcaagacggcggagaatggcaaggggagactgccggggtatattctg
ggtgcgattccgcagttggcgctttacgtgatggcggcgtggacgggtgtcagtatggtg
agatga

DBGET integrated database retrieval system