KEGG   Zymoseptoria tritici: MYCGRDRAFT_69942Help
Entry
MYCGRDRAFT_69942  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ztr  Zymoseptoria tritici
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ztr00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 313 aa AA seqDB search
MPEALDYKTFVVPLVIVVVAILGGFFFLTGEESPKDRPQPPAPEKAQQESRGPNTAIDPK
TFTEFPISEKTQTSHNTAIYRFKLPTEDSILGLPIGQHISLAADLDVTDPKTGEVQNKEV
VRSYTPISSDVTPGHFDLLIKSYPTGNISRHLATLNVGDKMKVRGPKGAMVYTPNMVRRF
GMIAGGTGITPMLQVCQAIRRGRKDGDKTEVDLIFANVNEEDILLREDLDALAKEDGFNV
YYVLNNPPSGWTGGVGFVTADMIKERLPAPAKDVKILICGPPPMVSAIKKATESLGFDKA
RPVSKLEDQVFAF
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagccttggactacaagacctttgtcgttcctctcgtcatcgtagtcgtcgcc
atcctcggtggcttcttcttcttgaccggcgaagagtcgccgaaagatcgccctcagccg
cctgctcccgagaaggcacagcaagaatctcgcggaccgaacactgccatcgacccaaag
accttcaccgaatttccaatctccgagaagacccaaacatcgcacaacaccgccatctac
cgcttcaagcttcccacagaggacagcatcctcggccttccaatcggccagcacatctcc
ctcgccgcggacctcgacgtcaccgacccaaagaccggcgaagtgcagaacaaggaagtc
gtacgatcatacacgccgatctcttcagatgtcacgcccggccactttgacctgctgatc
aagagctatccgaccggtaacatctcccgccatctcgcgactctcaatgtcggtgataag
atgaaggtgcgtgggccaaagggcgccatggtatacactcccaacatggttcgtcgcttt
ggaatgatcgcaggtggtaccggtatcacaccaatgcttcaggtctgtcaggcgattcgc
cgtggtcgcaaggacggtgacaagacagaggttgaccttattttcgccaacgtcaatgag
gaggacatcttgctcagggaggatctcgatgctttggctaaggaggatggcttcaacgtc
tactatgttctgaacaaccctccatctggatggaccggtggtgtcggctttgtgaccgca
gacatgatcaaggaacgtctccctgcacctgcaaaggacgtcaagatcctcatctgtggt
cctcctcctatggtttctgcgatcaagaaggccaccgagtcattgggcttcgacaaggct
cgaccagtcagcaagctcgaggatcaagtcttcgccttctaa

DBGET integrated database retrieval system