KEGG   Zymoseptoria tritici: MYCGRDRAFT_69980Help
Entry
MYCGRDRAFT_69980  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ztr  Zymoseptoria tritici
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 1442 aa AA seqDB search
MAGSENGSERSLAGAGRVVGARSASPAKRSATAMEEGVVDSIMDESTPRPVEDEQEQETV
THVEDTAMSGMTPASVALETQEMDINSASTSTNGNDSTSTSASSLLEERVDEQVAHVTRL
GQAQLDEGVKGVVVSSKWLERVLSRSTEGLQNREYPKEARDGLVGPMDNSDIVPEGAFEK
PYLMDVSKEAFIPLKPGLTLNSEIQILPFDAYGYIISEYGHVHSKPIIRYAHNTANSGSD
QQNVVYELYPPVVTIRKVPRPDSQAEAVKPKSGTGSLPALKLKKEARDRKEADAVRLVSS
KSEKVQNFLARCKEAAGISRETKVKVFRLIDPTIPAANRSDSAPSGVPSPPDSRSTSPAS
TTGNVPKLILDSETFGKMKGGTNLEPLELKDQTGNVNFNGGSMNVQMAGVHEDMTLVLEE
TLGGIRAGQFQSDAQNSLKIPKSAGSLPASTTASGRTSPAPERMMTRGRARKDGRPPGVV
GLQNLGNTCYMNSALQCIRSVEELAIFFLTKKYKKEINNDNPLGHHGRMANAYHSVIEGI
YGNNNNSSFRPSHFKTALGNAQPMFSGYGQQDSQEFLSFLVDALHEDLNRIKKKPYIENP
DSNDATVHLPEAIIELGETYRNNHRLRNDSVAMDLFSGFYKNKMECPKCDKVSVTFDPYS
LLTVQLPVNVSFNHTVVFVPLQGPPVRQRVDIDNNATVKALKESVASKHPGVEASRTTAV
EIWHKKVYNVFDDRLSLQEAAIKSHDDIFIYELDGVPTNPATADKYSSYMSKREKVPAGG
MDAPQADCFAVPIIHRLQGSRNPSDEIMYPLFITVTREEAKDYDVILKKTLQAVANMTTR
PILKEFTEASVVKKDDSEAEMVDAEPAPNEDSAGVSDHSAQSEDGYVNVSHASAATDSQI
LTNGTSAMQIDEPGEDAGVPHGFMDPEYFLSPALRTHLFEMKYSSNNNDNLYPGNNTSYN
SYVHPMVGRVKALSRRSSTQSSRSDETSSTTNGTAKSEESDADDDEERPDIVLGETIVLD
WKAEAVNALFEGGDNDADGLRGRRTMDDEGRHGPIFDDPELEARVAKRARRHKHGVTLEE
CFAETGKREVLSEDNTWFCNRCKDHRRAAKTLEIWTLPDILVVHLKRFGGGRGSRDKLDI
NVEFPIEGLDMTDKVGLKEDGKEYIYDLFAIDLHFGGLGGGHYTAMAKNWETGDWYDYND
ASCSKITDLERLQQSAAYLLFYRRRSNTPLGNADLQELVNKYKNPSSDDEELDAGEGQLG
GPIRSSHGPSSGSQVGVGTADTPRSLLGTSLLDGTAVGGGGIGAVERNLNPRRITNFSAD
DALPSYSASGATWGFDGLRTDAVLGGGAEGDDDDDGASTTAQGFRDNDSGMGDDTPPLLT
VSDGEWIDDDASDEVEEMSRDIFDPPSRRGSVLARELEADFREADEPEAVDITLPGQEDL
YD
NT seq 4329 nt NT seq  +upstreamnt  +downstreamnt
atggcagggagcgagaatggaagtgaacgttcgttggctggtgcaggtagagtggtggga
gcgaggagtgcgagtccggcaaagaggagtgctacggcgatggaggaaggtgttgtggac
tcaataatggacgagagcacgcctcgcccggtggaggatgagcaagagcaagagacggtc
acacatgtcgaggatacggcaatgtcgggaatgacgccggcgagtgttgcgttggaaacg
caggagatggacattaacagtgcctctacttcgacaaacggcaatgattcgacaagcacg
tcagcatccagcctgttggaggagcgagttgatgaacaggtcgcgcatgttacaagacta
gggcaagcacagttggatgagggcgtcaaaggagtcgttgtgtcgtcaaagtggctcgag
cgggtcctttcacgaagcacggaaggcttgcagaaccgcgagtatccaaaagaagcccgc
gacggactcgtgggacctatggacaactctgacattgttcctgaaggtgctttcgagaag
ccctacctgatggatgtgtcgaaggaagctttcattccgctcaagcctggtctcaccctc
aattcggagatacaaatcctgcccttcgatgcgtacggctacatcatcagcgaatatggc
cacgttcattccaagccgatcatccggtatgcacacaatactgccaactccggcagcgac
cagcaaaacgtcgtctacgagctataccctcctgtcgtcaccattcgcaaggtcccacgg
ccagattcacaagcggaggccgtcaagccgaagtctggaaccggatctctgcccgcgctg
aaattgaaaaaagaagcacgcgatcgcaaggaggctgatgctgtccgtctggtctcgtcc
aagagtgaaaaggtccaaaacttccttgctaggtgcaaggaggcagcgggcatttctcgt
gagaccaaggtcaaggtattccgcttgattgatccaacaatccctgcagccaatcgctcc
gatagtgctccgtctggcgtcccatcgcctcccgattcgaggagtacttctcccgcgagt
acaactggtaacgttccaaagcttattctcgactcggagactttcggcaagatgaagggt
ggtacgaatcttgagcctttggaattgaaggatcagactggcaatgtaaatttcaatggc
ggcagcatgaatgtgcaaatggctggtgttcacgaagacatgactctggttttggaggag
acccttggcggtatccgtgcaggacaattccaatccgatgcgcagaacagcctgaagatt
ccgaagtcggccggctcgttgcctgcctcgacgactgcctctggtcgaacaagtcctgca
cccgagcgcatgatgacacgaggtcgagcacgaaaggatggacgaccgcctggcgtcgtt
ggactgcagaacctcggtaatacctgttacatgaattcagctctgcaatgcattcgcagc
gtcgaggagctcgccatcttcttcctcaccaagaaatacaagaaggagatcaacaacgac
aatccgcttggacatcatggtcgcatggcaaatgcgtaccacagcgtaatcgaggggatc
tacggcaacaacaacaacagttccttcaggccgagccacttcaagactgctcttggaaat
gcacagccaatgttctctggctatggccagcaggattcgcaggaattcctcagctttctg
gtcgacgcacttcacgaagatctgaaccgcatcaagaagaagccatatatcgagaatccg
gactccaacgatgctaccgttcaccttccggaagccatcattgagctaggtgagacgtac
cgcaacaaccatcgtctacgaaacgactccgtcgccatggatcttttcagcggcttctac
aagaataaaatggaatgccccaaatgcgacaaagtcagcgtcacgttcgatccttactcc
ctcctcaccgtccagctccctgtcaatgtcagcttcaaccatacagtcgtcttcgtgccc
ctccagggaccgcctgttcgccaacgcgtggacatcgataacaacgccaccgtcaaggcg
ctcaaggagtccgttgccagcaagcaccccggtgtcgaggccagccgaacaacggcagtt
gaaatatggcataaaaaggtctacaatgtgttcgatgatcggctgagcctccaagaagca
gctatcaaaagccacgatgacatcttcatttacgagcttgacggcgtgccaacaaatcct
gccacggcggacaagtacagctcctacatgagcaagcgcgaaaaggttccggctggtggc
atggatgcgccgcaagcggactgctttgctgtaccaatcatccatcgactgcagggctcc
agaaatccatcagatgagataatgtatccgttgttcatcacggtcacgagagaagaggcg
aaggactacgatgtgattctcaagaagactctgcaagcagttgcgaacatgactacccga
cccatcttgaaggagttcaccgaggcatcagtcgtgaagaaggatgacagcgaggccgaa
atggtcgatgccgagcctgctccgaacgaggactccgccggcgtcagcgaccattccgcg
cagtcagaggatggctacgtcaatgtgtcgcacgcttcggcggcgaccgactcccagatc
ttgacaaacggcaccagcgccatgcagattgatgaacctggcgaagacgctggcgtgccg
catggattcatggacccggagtacttcctctctccagctttgcgaactcatcttttcgag
atgaaatattcgtcaaacaacaacgacaatttgtacccagggaacaacacctcttacaat
agctatgtccatcctatggttggtcgtgtcaaagcgctttcacgaaggagttcgacgcag
tcgagtcggtctgatgaaacctcttcgaccacaaacggcaccgcgaagagcgaggagagc
gatgcggatgacgacgaggagcgaccagacattgttctcggtgagacgatcgttcttgac
tggaaggccgaagccgtaaacgcactgttcgagggcggggacaatgatgcagacggactt
cgcggccgtcgtaccatggatgacgaaggtaggcacggccctatcttcgatgatcctgag
ctcgaggctcgtgtcgctaagcgcgctcgacgccacaagcatggtgttactcttgaggaa
tgcttcgcggagactggcaagcgcgaggttctctccgaggacaatacatggttttgcaat
cgatgcaaggaccaccgtcgcgcggccaagacgctcgagatctggacgttgccggacatt
ctggtcgttcacctgaagcgtttcggcggcggtcgtggctcccgtgacaagctggacatc
aacgtcgaattcccgatcgaaggcctggacatgactgacaaggtgggtctgaaggaggac
ggcaaggaatacatctacgacctcttcgccatcgatctgcacttcggcggcctcggaggt
ggccactacactgccatggccaagaattgggagaccggcgattggtatgactacaacgac
gcctcgtgcagcaagatcaccgacctcgagcgactgcaacagtccgccgcctacttgctc
ttctaccgtcgtcgctcaaatacgcctctcggcaatgcggacttgcaggaacttgtcaac
aagtacaagaatccctcgtccgacgatgaggagcttgacgcgggggaaggtcagctcggc
ggcccaatacgctcatcgcatgggccgtcgagcggttcacaagtcggagtcggaaccgcg
gatacgccgaggagtctactgggaacgtcactcctggacggaacggcggtcggaggtggt
ggaattggggcagtcgagaggaatctgaatccgaggaggatcactaatttcagcgccgat
gacgcactaccctcgtactctgctagtggcgcgacgtggggatttgacggattgagaacg
gatgctgttctgggtggaggagcggaaggcgatgatgacgatgatggagcgagcacgact
gcgcaggggttccgggacaatgattctgggatgggagacgacacgcctcctttgctcact
gtttcggatggcgagtggattgacgacgacgcttccgatgaagtcgaggaaatgagtcgg
gacatattcgacccgccgtcgcggcgaggctcagtgcttgcccgggagcttgaggcggac
ttcagagaggcggatgagccggaagcggtggacatcacgctgcccgggcaggaggacctg
tacgattaa

DBGET integrated database retrieval system