KEGG   Zymoseptoria tritici: MYCGRDRAFT_70199Help
Entry
MYCGRDRAFT_70199  CDS       T02285                                 

Gene name
ACC1
Definition
(RefSeq) acetyl-CoA carboxylase acc1
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ztr  Zymoseptoria tritici
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MYCGRDRAFT_70199 (ACC1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYCGRDRAFT_70199 (ACC1)
   00640 Propanoate metabolism
    MYCGRDRAFT_70199 (ACC1)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    MYCGRDRAFT_70199 (ACC1)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    MYCGRDRAFT_70199 (ACC1)
Enzymes [BR:ztr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     MYCGRDRAFT_70199 (ACC1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     MYCGRDRAFT_70199 (ACC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 2269 aa AA seqDB search
MANGHTNGDAYPSAFAAKYNLAPHFIGGNELARAPPSKVKDFVTAHDGHTVITSVLIANN
GIAAVKEIRSVRKWAYETFGDERAIQFTVMATPEDLAANADYIRMADQYVEVPGGTNNNN
YANVELIVDIAERMGVHAVWAGWGHASENPKLPESLAASPNKIVFIGPPGSAMRSLGDKI
SSTIVAQHANVPCIPWSGTGVADVEVDDNNIVTVNDETYAKGCVTSVEEGLEAARKIGFP
VMVKASEGGGGKGIRKVDDEETFPALYKAAASEIPGSPIFIMKLAGNARHLEVQLLADQY
GNNISIFGRDCSVQRRHQKIIEEAPVTIASQKTFQQMEKAAVSLGRLVGYVSAGTVEYLY
SHADDKFYFLELNPRLQVEHPTTEMVSGINIPAAQLLVAMGCPLHRIRDIRLLYGADPHT
STNIDFNFEKEGSALQQRRPMPKGHCTACRITSEDPGEGFKPSSGTMHELNFRSSSNVWG
YFSVGAASSIHNFSDSQFGHIFAYGENRTASRKHMVVALKELSIRGDFRTTVEYLIKLLE
TPAFEDNTITTGWLDELISKKLTAERPDPMIAVICGAVAQAHVASEACLTEYKKGLEKGQ
VPSKDILKTVFPIEFIYEGSKYKFTATRSSADMYTLFINGSKALVGIRALSDGGLLVLLG
GRSHNVYWKEEVGAVRVSVDGKTCLLEEENDPTQLRTPSPGKLVKFAVGNGEHVKKGQAF
AEVEVMKMYMPLIAQEDGVVNLIKQPGATLEAGDILGILALDDPSKVKSAQPFLGQLPEM
GAPVVLGAKAPQRFSFLKGILTNILQGYDNQVIMNQTLTELIEVLRDPELPYGEWTSQAS
ALHSRMPQKLDAAFEQLVERSHSRKAEFPAKQISKTFERFLAENVPGGDGELLRTALAPL
TEILAKYQEGLKAHEFSVVNQLLEQYYSVESIFSARQNRDDEVILTLRDQNRDKVAGVVQ
TVLSHTRASAKNNLIIAILQAYRPNQPGIGNVGKYLRPSLQKLAELEGRPTAKVALKARE
LLIQAAMPSLEERTSQMEHILRSAVRESRYGESGWDHRQPDFDVIKEVVDSKYTVFDVLP
HFFVHSDPWVSLAALEVYTRRAYRAYKLKTIDYLTEGDAPFVLAWDFALRKVGEAEFGLP
VESSHPSSAPGTPSESFTRIHSISDMSYIGRQAGAGAEPSRRGAVVPVSFIDEADEYLMK
ALEAFPVAAGQKSSKKDAGSLMADLSLKRGPAATKPASDDELTAVCNVAIRDAESLDDKE
ILSRLLPIVKDFKDELLARRVRRLTFICGHKDGTYPGYFTFRGPAYEEDASIRHIEPALA
FQLELARLAKFNIKPVFTENRNIHMYEAIGKNAETDKRYFTRATVRPGHLRDIPTAEYLI
SEADRLMTDILDAMEIVGNNNSDMNHIFINFSAVFPLEPKAVEQALEQFLDRFGRRAWRL
RVTGAEIRIVCTDPKTGAPFPMRVIITNTSGYIIQVELYEERKSDKSNEWLFHSIGGTTK
IGSMHLRPVNTPYETKGALQPKRYKAHIMGTQYVYDFPELFRQAIENEWNKTSSQHPGMR
EKQPVKGECIEYNELVLDDNDNLAEVNRDAGANTIGMVGWIVTAKTPEYPRGRRFIIISN
DITHKIGSFGPNEDKFFHKCSELARKLGIPRIYLSANSGARIGMAEELIPHFSVAWKDPS
RQEAGFEYLYLTPEKKARFEDGALKHVLTEEIQVGNETRHKITTIIGAEDGLGVECLKGS
GLIAGETSRAYEDIFTVTLVTCRSVGIGAYLVRLGQRAIQIEGQPIILTGAPAINKLLGR
EVYTSNLQLGGTQIMYKNGVSHQTANDDFEGVSKIVRWLSFVPEKKGAPVPISPSVDSWD
RDVTFYPPQKAPYDVRHLIAGQHTDEGFNSGLFDKDSFEETLGGWARTVVVGRARLGGIP
VGVIGVETRSVENVSPADPANPDSMEQVVNEAGGVWYPNSAFKTAQAIKDFNNGEQLPLM
ILANWRGFSGGQRDMYNEVLKYGSYIVDALVKYEQPVFVYIPPHGELRGGSWVVVDPTIN
PDFMEMYADEEARGGVLEPEGIVGIKYRKERQLETMARLDETYGDLKRRSQAKDLTPQEQ
NDIKAQMTERENLLLPVYLQVSLQYADLHDRAGRMKAKDTIRMPLKWANARRFFYWRLRR
RLNEEYVLKRISGSQSKELVSRGSNLKTLESWSGLPSYSTDDKAVAMWFEENRKVITDKI
EAIKTDAVAYDVAALMRSHKNGGLKGVAQVLSMLPVEEKEEVLKWLESA
NT seq 6810 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacggccacacgaatggcgacgcctacccgagtgcgttcgccgcgaaatacaac
ctggcaccacacttcatcggaggcaacgagctagcacgagcaccacctagcaaagtcaag
gactttgtcaccgcacatgatggtcacactgtcatcacgagcgtcctcattgcgaataac
ggtatcgccgctgtgaaagagatccgatccgtacggaaatgggcatacgagaccttcggc
gacgagcgggccatccagttcactgtgatggccacgccggaagatttggctgccaatgcc
gactacatcagaatggcagatcaatacgtggaagtgcctggtggcaccaacaacaacaac
tatgccaacgtggagctgattgttgacattgctgagcgcatgggcgtacacgccgtgtgg
gcaggatggggacacgcatcagagaacccgaagttgcccgaatcactcgctgcgtcgccg
aacaagattgtcttcattggaccgcctggctcggcgatgcgatcgcttggtgacaaaatc
tcctccacaattgttgcacagcacgcgaatgtgccctgtatcccctggtccggaactggc
gtggctgacgtcgaggtggatgacaataacattgttacggtcaacgatgagacctatgcc
aagggctgcgtgacctccgtcgaggaaggtctggaagccgcgaggaagattgggttcccg
gtcatggtcaaagcctctgagggtggtggtggaaagggtatccgaaaggtcgacgatgag
gagaccttcccagcactatacaaggccgctgcgagtgaaattcctggctcgccaatcttc
atcatgaagctcgcaggcaatgccagacatttggaagtccaacttctggctgatcagtac
ggaaacaacatctccatcttcggccgtgattgttcggtccaacgaagacatcaaaagatt
atcgaagaagcacctgtcacgattgccagccaaaagaccttccagcaaatggagaaggct
gccgtctctctcggacggttagtcggctacgtctctgctggtaccgtcgaatatctctac
tcacacgccgacgacaaattctacttcctggaactcaaccctcgtcttcaggtcgagcat
cccaccactgagatggtctctggcatcaacatcccagcagctcaactcttggttgctatg
ggatgccctctccaccgcatccgtgacattcgcttgctctacggcgcggacccgcacact
tccaccaacatcgacttcaactttgagaaagagggcagcgctctccagcaacgccggccg
atgccaaagggacactgcacggcttgccgcattacctctgaagaccctggtgagggcttc
aagccgtcgtccggaaccatgcatgaactgaacttccgttcgagctctaatgtttggggt
tatttctccgtcggagccgcttcctcgattcacaacttctccgattcgcaattcggccac
atcttcgcgtacggcgagaaccgaacagcatcccgaaagcacatggttgttgcattgaaa
gagctgagcattcgtggcgacttccgcacaacggtcgagtacttgatcaagctgttggag
actccagctttcgaggacaacaccattacaaccggctggctcgatgagctgatcagcaaa
aagctgacggctgagcgtcccgatcctatgattgccgttatttgcggtgctgtggctcag
gcgcacgttgcaagcgaagcatgcctgaccgagtacaagaagggtcttgaaaagggtcag
gttccgagcaaagacatcctcaagacggtcttcccgatcgaattcatctacgagggcagc
aagtacaagtttactgcaacccgatcctccgctgacatgtacacattgttcatcaacggc
agcaaggcgctggtcggaattcgcgccctctctgatggaggacttttggttctgctcggc
ggtcgctctcacaacgtgtactggaaggaggaggttggtgccgttcgtgtctcagtggat
ggcaagacttgcttgctcgaggaggagaacgacccaactcagcttcgtactccatcgcca
ggaaagctcgtcaagtttgctgttggaaacggcgagcacgtcaagaagggccaagctttc
gccgaagtcgaggtcatgaagatgtacatgcctctgatcgcacaggaggatggtgtcgtc
aacctcatcaagcaacccggcgccaccctcgaagctggtgacattctcggaatcctcgct
ctcgacgatccgtcaaaggtcaaatctgcacaacccttcctcggacagctcccagaaatg
ggtgcacctgtcgtcctcggtgccaaggcaccgcagcgcttcagcttcctgaagggtatc
ttgacgaacattctccagggctacgacaaccaggtcatcatgaatcagactcttaccgag
cttatcgaagtgctccgtgaccctgagctaccttatggcgaatggacctcacaggcctct
gcgctgcactctcgcatgccgcagaagcttgacgcggccttcgagcaactcgtcgagcgc
tcgcatagccgaaaggccgagttcccggctaagcagatctcgaagaccttcgagcgattc
ctcgcggagaacgttcctggcggcgatggagaactccttcgcactgctctggctcctctg
acggagatcctcgccaagtaccaagaaggtctcaaggcacatgagttctcggttgtcaat
cagcttcttgagcaatactactctgtggaaagcatcttctcggcccgccagaaccgcgat
gacgaggttattctcacacttcgcgaccaaaatagggacaaggtggccggtgttgttcag
accgttctgtctcacactcgagcaagcgccaagaacaacctcatcattgccattctccaa
gcttacaggcccaaccagccaggcatcggaaatgtcggcaagtatctccgaccatcgctc
cagaagctcgctgagcttgaaggtcgtccgaccgccaaggtcgccctcaaggctcgtgag
ctgctcattcaggccgcgatgccatcgctcgaggagcgtacctcccagatggagcacatt
ctccggtctgccgtccgcgagtcacgctacggagaaagtggatgggaccacaggcaaccc
gatttcgatgtcatcaaggaggtcgtcgattccaagtacaccgttttcgatgttctgccg
cacttcttcgtccactcggatccttgggtttctctcgcggctttggaagtgtacacccgc
cgcgcttaccgtgcttacaagctaaagaccattgactatctgactgaaggcgatgctcct
ttcgttcttgcgtgggacttcgcccttaggaaggtcggagaggctgagtttggtctgcca
gtggaatcttcgcatccatcctccgctcctggaacgccatctgagagcttcactcgcatc
cactcgatcagcgacatgagctacattggacgtcaagcaggtgccggcgcggagccaagc
cgccgaggtgccgttgtgccagtcagcttcatcgacgaggccgatgagtacctgatgaag
gcgttagaggctttcccagtggctgctggtcagaagagcagcaagaaagatgccgggtct
ttgatggccgatctctcgctcaagcgcggacctgccgccaccaagcctgcgagcgatgat
gagctcactgccgtctgtaacgttgccatccgcgatgccgagagcttggacgacaaggag
attctgtctcgtctgttgcccatcgtcaaagacttcaaggacgagcttctcgctcgccgt
gtgcgccgtctgacatttatctgtggccacaaggatggcacatatcccggctacttcacc
ttccgcggacccgcctacgaggaggatgccagcatacgtcacatcgagcctgcgcttgct
ttccagctcgagcttgctcgtcttgccaagttcaacatcaagccagtgttcacggagaac
cgcaacatccacatgtacgaggccattggcaagaatgccgagaccgacaagcgatacttc
acacgtgctaccgttcgacctggtcacctcagggatattcccactgccgagtacctgatc
tcggaagcagacaggctgatgaccgacatcctcgacgccatggagatcgttggcaacaac
aactccgacatgaaccacatcttcatcaacttctccgctgtcttcccacttgaacctaag
gcggtcgagcaggctttggaacagttcttggaccgtttcggacgtcgtgcttggagactt
cgtgtcactggtgctgagatccgtatcgtttgcaccgacccaaagaccggtgctccgttc
ccaatgcgtgtcatcatcaccaacacttctggatacatcatccaggtcgagctatacgaa
gagcgcaagtctgacaagagcaacgaatggctcttccacagtatcggaggtaccacaaag
atcggctccatgcacttgcgcccggtcaatactccttacgagaccaagggtgcactccag
cccaagcgttacaaggctcacatcatgggcacacaatacgtctacgacttcccagagctg
ttccgacaggccattgagaatgagtggaacaagaccagcagccaacacccgggcatgagg
gagaagcagcctgtcaagggagagtgcattgagtacaatgagcttgtgcttgatgacaac
gacaacttggcggaggtaaaccgcgacgctggtgccaacaccatcggcatggtcggctgg
atcgtgacggcgaagacacccgagtacccacgcggtcgtcgcttcatcatcatctccaac
gacatcacccacaagattggttcatttggacccaacgaggacaagttcttccacaagtgc
tcggagctcgcccgcaagcttggcattccgcgcatttatctctctgccaactctggtgca
cgcattggaatggctgaggagctcatcccacatttctccgtcgcctggaaagacccaagc
agacaggaggctgggttcgagtatctctacctcacgccagagaagaaggctcgcttcgag
gacggtgctctcaagcatgttctcaccgaggagattcaagtcggcaatgagacgcgtcac
aagatcactactatcattggtgctgaagatggtcttggtgtcgagtgcttgaagggctct
ggtctcatcgccggtgagacctcacgtgcgtacgaggacattttcaccgtcactctcgtt
acttgccgttccgtcggtatcggtgcctaccttgtccgcctgggacagcgtgcgatccaa
attgagggtcagccaatcatcctcactggtgctccggccatcaacaagctcttgggtcgt
gaggtctacacctctaacttgcaactgggtggtacccagatcatgtacaagaacggtgtt
tcccatcagaccgccaacgatgacttcgagggtgtctcgaagatcgttcgctggttgtcg
ttcgtgccggagaagaagggcgcccctgtgccaatctcgccatctgtcgactcttgggat
cgcgatgtcacgttctacccacctcaaaaggcaccatacgacgtccgccacctcatcgcc
ggacaacacaccgatgagggtttcaactctggtctgttcgacaaagactccttcgaggag
actcttggcggatgggctcgtactgtcgtcgtgggtcgtgctcgtcttggcggcattcca
gtcggtgtcatcggcgtggagactcgctcggtcgagaacgtgtcgcctgctgatcctgcc
aaccctgactcgatggaacaggttgtcaacgaggccggtggtgtctggtaccccaacagc
gccttcaagactgcccaggccatcaaggacttcaacaatggagagcaacttcctctcatg
attctcgccaactggagaggtttctctggtggtcagcgtgacatgtacaacgaggtcctc
aagtatggctcctacatcgtcgatgcgctcgtcaagtacgaacagccggtgtttgtgtac
attccgccacacggagagcttcgtggtggttcatgggtcgtcgtcgatcctaccatcaac
ccagacttcatggagatgtacgccgatgaggaggctcgcggtggtgtcctcgagccggaa
ggtattgtcggtatcaaataccgcaaggagcgccagctcgaaactatggctcgtctcgat
gagacctacggcgacctcaagcgccgctcgcaagccaaggatctcacgccgcaggagcaa
aacgatatcaaagcgcaaatgaccgagcgtgagaacctcctcctgccagtctacctccag
gtctcccttcaatacgccgacctgcacgaccgcgccggccgcatgaaggccaaggacaca
atccgcatgccactgaaatgggccaacgcgcgccgcttcttctactggcgcctccgccgc
cgtctcaacgaggagtacgttctcaagcgcatctccggctcgcagtccaaggagctcgtc
agccgtggcagcaacctgaagacgctggagtcgtggtccggattgccgtcgtacagcacc
gatgacaaggccgtcgccatgtggttcgaggagaaccgtaaggtcatcaccgacaaaatc
gaggcgatcaagacggatgctgtggcgtacgatgttgcggcgctgatgaggagccataag
aatggtgggctcaagggtgtggcgcaggtgttgagcatgttgcctgtggaggagaaggag
gaggtgctcaagtggttggagagtgcatag

DBGET integrated database retrieval system