KEGG   Zymoseptoria tritici: MYCGRDRAFT_70199Help
Entry
MYCGRDRAFT_70199  CDS       T02285                                 

Gene name
ACC1
Definition
acetyl-CoA carboxylase acc1
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ztr  Zymoseptoria tritici
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ztr01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ztr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ztr00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:ztr00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis [PATH:ztr00254]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 2269 aa AA seqDB search
MANGHTNGDAYPSAFAAKYNLAPHFIGGNELARAPPSKVKDFVTAHDGHTVITSVLIANN
GIAAVKEIRSVRKWAYETFGDERAIQFTVMATPEDLAANADYIRMADQYVEVPGGTNNNN
YANVELIVDIAERMGVHAVWAGWGHASENPKLPESLAASPNKIVFIGPPGSAMRSLGDKI
SSTIVAQHANVPCIPWSGTGVADVEVDDNNIVTVNDETYAKGCVTSVEEGLEAARKIGFP
VMVKASEGGGGKGIRKVDDEETFPALYKAAASEIPGSPIFIMKLAGNARHLEVQLLADQY
GNNISIFGRDCSVQRRHQKIIEEAPVTIASQKTFQQMEKAAVSLGRLVGYVSAGTVEYLY
SHADDKFYFLELNPRLQVEHPTTEMVSGINIPAAQLLVAMGCPLHRIRDIRLLYGADPHT
STNIDFNFEKEGSALQQRRPMPKGHCTACRITSEDPGEGFKPSSGTMHELNFRSSSNVWG
YFSVGAASSIHNFSDSQFGHIFAYGENRTASRKHMVVALKELSIRGDFRTTVEYLIKLLE
TPAFEDNTITTGWLDELISKKLTAERPDPMIAVICGAVAQAHVASEACLTEYKKGLEKGQ
VPSKDILKTVFPIEFIYEGSKYKFTATRSSADMYTLFINGSKALVGIRALSDGGLLVLLG
GRSHNVYWKEEVGAVRVSVDGKTCLLEEENDPTQLRTPSPGKLVKFAVGNGEHVKKGQAF
AEVEVMKMYMPLIAQEDGVVNLIKQPGATLEAGDILGILALDDPSKVKSAQPFLGQLPEM
GAPVVLGAKAPQRFSFLKGILTNILQGYDNQVIMNQTLTELIEVLRDPELPYGEWTSQAS
ALHSRMPQKLDAAFEQLVERSHSRKAEFPAKQISKTFERFLAENVPGGDGELLRTALAPL
TEILAKYQEGLKAHEFSVVNQLLEQYYSVESIFSARQNRDDEVILTLRDQNRDKVAGVVQ
TVLSHTRASAKNNLIIAILQAYRPNQPGIGNVGKYLRPSLQKLAELEGRPTAKVALKARE
LLIQAAMPSLEERTSQMEHILRSAVRESRYGESGWDHRQPDFDVIKEVVDSKYTVFDVLP
HFFVHSDPWVSLAALEVYTRRAYRAYKLKTIDYLTEGDAPFVLAWDFALRKVGEAEFGLP
VESSHPSSAPGTPSESFTRIHSISDMSYIGRQAGAGAEPSRRGAVVPVSFIDEADEYLMK
ALEAFPVAAGQKSSKKDAGSLMADLSLKRGPAATKPASDDELTAVCNVAIRDAESLDDKE
ILSRLLPIVKDFKDELLARRVRRLTFICGHKDGTYPGYFTFRGPAYEEDASIRHIEPALA
FQLELARLAKFNIKPVFTENRNIHMYEAIGKNAETDKRYFTRATVRPGHLRDIPTAEYLI
SEADRLMTDILDAMEIVGNNNSDMNHIFINFSAVFPLEPKAVEQALEQFLDRFGRRAWRL
RVTGAEIRIVCTDPKTGAPFPMRVIITNTSGYIIQVELYEERKSDKSNEWLFHSIGGTTK
IGSMHLRPVNTPYETKGALQPKRYKAHIMGTQYVYDFPELFRQAIENEWNKTSSQHPGMR
EKQPVKGECIEYNELVLDDNDNLAEVNRDAGANTIGMVGWIVTAKTPEYPRGRRFIIISN
DITHKIGSFGPNEDKFFHKCSELARKLGIPRIYLSANSGARIGMAEELIPHFSVAWKDPS
RQEAGFEYLYLTPEKKARFEDGALKHVLTEEIQVGNETRHKITTIIGAEDGLGVECLKGS
GLIAGETSRAYEDIFTVTLVTCRSVGIGAYLVRLGQRAIQIEGQPIILTGAPAINKLLGR
EVYTSNLQLGGTQIMYKNGVSHQTANDDFEGVSKIVRWLSFVPEKKGAPVPISPSVDSWD
RDVTFYPPQKAPYDVRHLIAGQHTDEGFNSGLFDKDSFEETLGGWARTVVVGRARLGGIP
VGVIGVETRSVENVSPADPANPDSMEQVVNEAGGVWYPNSAFKTAQAIKDFNNGEQLPLM
ILANWRGFSGGQRDMYNEVLKYGSYIVDALVKYEQPVFVYIPPHGELRGGSWVVVDPTIN
PDFMEMYADEEARGGVLEPEGIVGIKYRKERQLETMARLDETYGDLKRRSQAKDLTPQEQ
NDIKAQMTERENLLLPVYLQVSLQYADLHDRAGRMKAKDTIRMPLKWANARRFFYWRLRR
RLNEEYVLKRISGSQSKELVSRGSNLKTLESWSGLPSYSTDDKAVAMWFEENRKVITDKI
EAIKTDAVAYDVAALMRSHKNGGLKGVAQVLSMLPVEEKEEVLKWLESA
NT seq 6810 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacggccacacgaatggcgacgcctacccgagtgcgttcgccgcgaaatacaac
ctggcaccacacttcatcggaggcaacgagctagcacgagcaccacctagcaaagtcaag
gactttgtcaccgcacatgatggtcacactgtcatcacgagcgtcctcattgcgaataac
ggtatcgccgctgtgaaagagatccgatccgtacggaaatgggcatacgagaccttcggc
gacgagcgggccatccagttcactgtgatggccacgccggaagatttggctgccaatgcc
gactacatcagaatggcagatcaatacgtggaagtgcctggtggcaccaacaacaacaac
tatgccaacgtggagctgattgttgacattgctgagcgcatgggcgtacacgccgtgtgg
gcaggatggggacacgcatcagagaacccgaagttgcccgaatcactcgctgcgtcgccg
aacaagattgtcttcattggaccgcctggctcggcgatgcgatcgcttggtgacaaaatc
tcctccacaattgttgcacagcacgcgaatgtgccctgtatcccctggtccggaactggc
gtggctgacgtcgaggtggatgacaataacattgttacggtcaacgatgagacctatgcc
aagggctgcgtgacctccgtcgaggaaggtctggaagccgcgaggaagattgggttcccg
gtcatggtcaaagcctctgagggtggtggtggaaagggtatccgaaaggtcgacgatgag
gagaccttcccagcactatacaaggccgctgcgagtgaaattcctggctcgccaatcttc
atcatgaagctcgcaggcaatgccagacatttggaagtccaacttctggctgatcagtac
ggaaacaacatctccatcttcggccgtgattgttcggtccaacgaagacatcaaaagatt
atcgaagaagcacctgtcacgattgccagccaaaagaccttccagcaaatggagaaggct
gccgtctctctcggacggttagtcggctacgtctctgctggtaccgtcgaatatctctac
tcacacgccgacgacaaattctacttcctggaactcaaccctcgtcttcaggtcgagcat
cccaccactgagatggtctctggcatcaacatcccagcagctcaactcttggttgctatg
ggatgccctctccaccgcatccgtgacattcgcttgctctacggcgcggacccgcacact
tccaccaacatcgacttcaactttgagaaagagggcagcgctctccagcaacgccggccg
atgccaaagggacactgcacggcttgccgcattacctctgaagaccctggtgagggcttc
aagccgtcgtccggaaccatgcatgaactgaacttccgttcgagctctaatgtttggggt
tatttctccgtcggagccgcttcctcgattcacaacttctccgattcgcaattcggccac
atcttcgcgtacggcgagaaccgaacagcatcccgaaagcacatggttgttgcattgaaa
gagctgagcattcgtggcgacttccgcacaacggtcgagtacttgatcaagctgttggag
actccagctttcgaggacaacaccattacaaccggctggctcgatgagctgatcagcaaa
aagctgacggctgagcgtcccgatcctatgattgccgttatttgcggtgctgtggctcag
gcgcacgttgcaagcgaagcatgcctgaccgagtacaagaagggtcttgaaaagggtcag
gttccgagcaaagacatcctcaagacggtcttcccgatcgaattcatctacgagggcagc
aagtacaagtttactgcaacccgatcctccgctgacatgtacacattgttcatcaacggc
agcaaggcgctggtcggaattcgcgccctctctgatggaggacttttggttctgctcggc
ggtcgctctcacaacgtgtactggaaggaggaggttggtgccgttcgtgtctcagtggat
ggcaagacttgcttgctcgaggaggagaacgacccaactcagcttcgtactccatcgcca
ggaaagctcgtcaagtttgctgttggaaacggcgagcacgtcaagaagggccaagctttc
gccgaagtcgaggtcatgaagatgtacatgcctctgatcgcacaggaggatggtgtcgtc
aacctcatcaagcaacccggcgccaccctcgaagctggtgacattctcggaatcctcgct
ctcgacgatccgtcaaaggtcaaatctgcacaacccttcctcggacagctcccagaaatg
ggtgcacctgtcgtcctcggtgccaaggcaccgcagcgcttcagcttcctgaagggtatc
ttgacgaacattctccagggctacgacaaccaggtcatcatgaatcagactcttaccgag
cttatcgaagtgctccgtgaccctgagctaccttatggcgaatggacctcacaggcctct
gcgctgcactctcgcatgccgcagaagcttgacgcggccttcgagcaactcgtcgagcgc
tcgcatagccgaaaggccgagttcccggctaagcagatctcgaagaccttcgagcgattc
ctcgcggagaacgttcctggcggcgatggagaactccttcgcactgctctggctcctctg
acggagatcctcgccaagtaccaagaaggtctcaaggcacatgagttctcggttgtcaat
cagcttcttgagcaatactactctgtggaaagcatcttctcggcccgccagaaccgcgat
gacgaggttattctcacacttcgcgaccaaaatagggacaaggtggccggtgttgttcag
accgttctgtctcacactcgagcaagcgccaagaacaacctcatcattgccattctccaa
gcttacaggcccaaccagccaggcatcggaaatgtcggcaagtatctccgaccatcgctc
cagaagctcgctgagcttgaaggtcgtccgaccgccaaggtcgccctcaaggctcgtgag
ctgctcattcaggccgcgatgccatcgctcgaggagcgtacctcccagatggagcacatt
ctccggtctgccgtccgcgagtcacgctacggagaaagtggatgggaccacaggcaaccc
gatttcgatgtcatcaaggaggtcgtcgattccaagtacaccgttttcgatgttctgccg
cacttcttcgtccactcggatccttgggtttctctcgcggctttggaagtgtacacccgc
cgcgcttaccgtgcttacaagctaaagaccattgactatctgactgaaggcgatgctcct
ttcgttcttgcgtgggacttcgcccttaggaaggtcggagaggctgagtttggtctgcca
gtggaatcttcgcatccatcctccgctcctggaacgccatctgagagcttcactcgcatc
cactcgatcagcgacatgagctacattggacgtcaagcaggtgccggcgcggagccaagc
cgccgaggtgccgttgtgccagtcagcttcatcgacgaggccgatgagtacctgatgaag
gcgttagaggctttcccagtggctgctggtcagaagagcagcaagaaagatgccgggtct
ttgatggccgatctctcgctcaagcgcggacctgccgccaccaagcctgcgagcgatgat
gagctcactgccgtctgtaacgttgccatccgcgatgccgagagcttggacgacaaggag
attctgtctcgtctgttgcccatcgtcaaagacttcaaggacgagcttctcgctcgccgt
gtgcgccgtctgacatttatctgtggccacaaggatggcacatatcccggctacttcacc
ttccgcggacccgcctacgaggaggatgccagcatacgtcacatcgagcctgcgcttgct
ttccagctcgagcttgctcgtcttgccaagttcaacatcaagccagtgttcacggagaac
cgcaacatccacatgtacgaggccattggcaagaatgccgagaccgacaagcgatacttc
acacgtgctaccgttcgacctggtcacctcagggatattcccactgccgagtacctgatc
tcggaagcagacaggctgatgaccgacatcctcgacgccatggagatcgttggcaacaac
aactccgacatgaaccacatcttcatcaacttctccgctgtcttcccacttgaacctaag
gcggtcgagcaggctttggaacagttcttggaccgtttcggacgtcgtgcttggagactt
cgtgtcactggtgctgagatccgtatcgtttgcaccgacccaaagaccggtgctccgttc
ccaatgcgtgtcatcatcaccaacacttctggatacatcatccaggtcgagctatacgaa
gagcgcaagtctgacaagagcaacgaatggctcttccacagtatcggaggtaccacaaag
atcggctccatgcacttgcgcccggtcaatactccttacgagaccaagggtgcactccag
cccaagcgttacaaggctcacatcatgggcacacaatacgtctacgacttcccagagctg
ttccgacaggccattgagaatgagtggaacaagaccagcagccaacacccgggcatgagg
gagaagcagcctgtcaagggagagtgcattgagtacaatgagcttgtgcttgatgacaac
gacaacttggcggaggtaaaccgcgacgctggtgccaacaccatcggcatggtcggctgg
atcgtgacggcgaagacacccgagtacccacgcggtcgtcgcttcatcatcatctccaac
gacatcacccacaagattggttcatttggacccaacgaggacaagttcttccacaagtgc
tcggagctcgcccgcaagcttggcattccgcgcatttatctctctgccaactctggtgca
cgcattggaatggctgaggagctcatcccacatttctccgtcgcctggaaagacccaagc
agacaggaggctgggttcgagtatctctacctcacgccagagaagaaggctcgcttcgag
gacggtgctctcaagcatgttctcaccgaggagattcaagtcggcaatgagacgcgtcac
aagatcactactatcattggtgctgaagatggtcttggtgtcgagtgcttgaagggctct
ggtctcatcgccggtgagacctcacgtgcgtacgaggacattttcaccgtcactctcgtt
acttgccgttccgtcggtatcggtgcctaccttgtccgcctgggacagcgtgcgatccaa
attgagggtcagccaatcatcctcactggtgctccggccatcaacaagctcttgggtcgt
gaggtctacacctctaacttgcaactgggtggtacccagatcatgtacaagaacggtgtt
tcccatcagaccgccaacgatgacttcgagggtgtctcgaagatcgttcgctggttgtcg
ttcgtgccggagaagaagggcgcccctgtgccaatctcgccatctgtcgactcttgggat
cgcgatgtcacgttctacccacctcaaaaggcaccatacgacgtccgccacctcatcgcc
ggacaacacaccgatgagggtttcaactctggtctgttcgacaaagactccttcgaggag
actcttggcggatgggctcgtactgtcgtcgtgggtcgtgctcgtcttggcggcattcca
gtcggtgtcatcggcgtggagactcgctcggtcgagaacgtgtcgcctgctgatcctgcc
aaccctgactcgatggaacaggttgtcaacgaggccggtggtgtctggtaccccaacagc
gccttcaagactgcccaggccatcaaggacttcaacaatggagagcaacttcctctcatg
attctcgccaactggagaggtttctctggtggtcagcgtgacatgtacaacgaggtcctc
aagtatggctcctacatcgtcgatgcgctcgtcaagtacgaacagccggtgtttgtgtac
attccgccacacggagagcttcgtggtggttcatgggtcgtcgtcgatcctaccatcaac
ccagacttcatggagatgtacgccgatgaggaggctcgcggtggtgtcctcgagccggaa
ggtattgtcggtatcaaataccgcaaggagcgccagctcgaaactatggctcgtctcgat
gagacctacggcgacctcaagcgccgctcgcaagccaaggatctcacgccgcaggagcaa
aacgatatcaaagcgcaaatgaccgagcgtgagaacctcctcctgccagtctacctccag
gtctcccttcaatacgccgacctgcacgaccgcgccggccgcatgaaggccaaggacaca
atccgcatgccactgaaatgggccaacgcgcgccgcttcttctactggcgcctccgccgc
cgtctcaacgaggagtacgttctcaagcgcatctccggctcgcagtccaaggagctcgtc
agccgtggcagcaacctgaagacgctggagtcgtggtccggattgccgtcgtacagcacc
gatgacaaggccgtcgccatgtggttcgaggagaaccgtaaggtcatcaccgacaaaatc
gaggcgatcaagacggatgctgtggcgtacgatgttgcggcgctgatgaggagccataag
aatggtgggctcaagggtgtggcgcaggtgttgagcatgttgcctgtggaggagaaggag
gaggtgctcaagtggttggagagtgcatag

DBGET integrated database retrieval system