KEGG   Zymoseptoria tritici: MYCGRDRAFT_70219Help
Entry
MYCGRDRAFT_70219  CDS       T02285                                 

Gene name
HAG2403
Definition
histone acetyltransferase type B catalytic subunit
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MYCGRDRAFT_70219 (HAG2403)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 499 aa AA seqDB search
MSSDSIEDDEDLAQEKQLVNEWSSNSNECLNIRLVRGNGSVAVSCNPEFTYAMFGEEEAI
FGYQDLNINLSFRAHDLQPKLDITYGKIFPVQGEVRPTDIAKALSDFLPESAFDNQELGV
EADFGPPGEKIHDYKRNGKAYEVWCASLADPAAKKLLENMQILVPFFIDGGSVLELEQDW
TTQRWKIFLVYEVDGQANGISPYTLAGYGTSYRCFTFPERQKAPNELSHISDFESPLDLP
SRERLSQFLLLPPFRGAGHGQELYKVMYKHLTSPDNIREFTVEDPNETFDDLRDFCDLLY
LRANVPEFAALRIHTDIPTEKMASTASIPTDLIVPIDQRKEIMRRTKLMPRQFDRLVEMH
TLSFIPTSNRSRNRITRKEKTTNEHDRQYYFWRLYVKQRLYIFNRDQLAQVEHAERVEKL
EGALDSVLEAYTEMIERVQTKEEDIANGQVDGDAAPSTAGATKRKRKVVEEDEDEESESG
AEQDEVAPSTNGHKKAKAA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgattccatcgaggacgacgaggacctcgcgcaagagaaacagctggtcaac
gagtggtcaagtaacagcaatgagtgcttgaacatccggctcgtgcgcggtaatggctcg
gtcgcggtgtcatgcaatccggagttcacctatgccatgttcggcgaagaagaggcaata
tttggttaccaggacttgaacatcaacctctctttccgtgcgcatgacctgcaaccgaag
ctggacatcacctacggcaagatattccctgttcagggcgaagtgcgacctaccgatatt
gcaaaggcactatcagatttccttcctgaatccgcgttcgacaaccaagagctgggcgtc
gaggcggactttgggccaccaggcgagaagattcacgactacaagcgtaatggaaaggct
tacgaagtctggtgtgcgagtctggcagatcctgctgctaagaagctgcttgagaatatg
cagattttggtgcccttcttcattgatggtggaagtgtgctggaactggagcaagattgg
acgacgcaacggtggaagatcttcctcgtctacgaggtcgacggacaggcaaacggcatc
tcaccttacacactcgcaggatacggcacgtcgtatcgctgcttcaccttcccagaacgc
caaaaggctccgaatgagctttctcatatctccgacttcgaatcacctcttgatctaccg
agccgcgagcgactatcacaattcttgctgctaccaccattccgtggtgcgggccacgga
caggagctgtacaaggtgatgtacaagcatcttacttctcccgataacattcgagagttc
acagtcgaggatccgaacgagacctttgatgacctgcgcgacttctgcgacttgctatac
ctacgcgccaatgttcccgaattcgcagcacttcgcattcacaccgacattcctactgaa
aagatggccagcacggcttccatacctaccgatctcattgttccgatcgatcagcgcaag
gagattatgaggaggactaagttgatgccacgtcaatttgatcgtcttgtcgagatgcac
accctctcgttcattcccaccagcaaccgatcgaggaaccgaattacaaggaaggagaag
actacaaacgagcacgaccgacagtactacttttggcgtctgtatgtcaagcagcgtctc
tacattttcaatcgcgaccagctggctcaagtggagcacgcggagagggtggagaaattg
gaaggtgcccttgacagtgttctggaagcttacaccgaaatgatcgagagggtccaaacg
aaggaagaggacattgcgaacgggcaagtcgatggtgacgcggcacccagcaccgccggc
gcaacgaaacgcaaacgcaaggtcgtagaggaggatgaagacgaagaaagcgaatcggga
gcagagcaggatgaagtcgcgccaagcaccaatggtcataagaaagccaaagccgcatga

DBGET integrated database retrieval system