KEGG   Zymoseptoria tritici: MYCGRDRAFT_70343Help
Entry
MYCGRDRAFT_70343  CDS       T02285                                 

Gene name
CYP-50
Definition
putative P450 monooxygenase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
ztr  Zymoseptoria tritici
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    MYCGRDRAFT_70343 (CYP-50)
  Amino acid metabolism
   00380 Tryptophan metabolism
    MYCGRDRAFT_70343 (CYP-50)
Enzymes [BR:ztr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     MYCGRDRAFT_70343 (CYP-50)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     MYCGRDRAFT_70343 (CYP-50)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 1061 aa AA seqDB search
MVSTKTVPRPWGLPLIGNVPSIDMGYPLGSLNSLADRYVGEIYQLNLIGKEALFISTHKL
FAEVCDETRFQKHLLAPLVQLRNVVGDGLFTAFPGETNWEIAHRTLMPAFGPLPIQSMFA
EQHDIASQLVLKWARFGPDHDIAVTDDFTRLTLDTIPLCSMDMRFNSFYHDDLHPFVDAM
VGVLAAAGDRARRPDVADYVLRAQRAKFDKDIAYLRKLSTELVARRREKGTQKKDLLNAL
LNNKDPKLGVGMTDDSIVDNMVTFLVAGHETTSGLLSFLFYELTSSPEAYKKAQQEVDEV
VGSGAVNVGHLSKLPYLTACLRETLRLHSTAPAISVTALKDDIIGGQYAVKKGQGINCLL
AKIQSDPAVWGTDASEFKPERMLDEIFNKLPAHAWKPFGNGVRGCIGRAFAWQEALLTVA
LLLQIFNFRKTDPSYKLEVAMTLTIKPKNFTMRATMRDPSILERLGAVSVSGEVSSAKAT
TQHARTSSLAAVESAGTTINILYGSNTGTCESLASSLGSTAKSRGYKAYVDTLDNGMSSI
SADKPTVIITASYEGQPPDNAMKFSKWLNSDESSSLAKSKYAVFGVGNREWVTTYQRQPK
LIDEVMGQKGAESLVDRGIADVCDGDIFNAFDRWTDEKLWPAVDAAFSAGKSAASSDEGL
SITVDTESRVKQLRQDVQAAVVQDVKLLTAPGKPAKRHIQLKLPPGTDYKAGDYLTVLPV
NPEPSVRRAMARFKLTWDATITIDSSSQTTIPTGRPISAFDVFASYVELGQPATDKQISQ
LASTIPDEKDRQSLTNTSLKPAAKTKTPSLLELLETYPTATYTLSQFLAAVPSMRTRQYS
ISSSPLVDPGSASLTYSVLDAPANPASPADGKRFLGVASNYMARAQPGDHIQVALRPSHA
GFHLPSDDSKPVLMACAGTGLAPFRAFVEERAVKIAAGKNLGPAILFFGCNAPDEDDMYR
SEFDAWTKSGAVDVRRAYTFAPEKSEGCKFVQHRVWHDRKEMVELIQKDACMYICGAGVV
GAALVDVVQRIYVEYKGCTEEEAKKWFEGLRGERYWSDIFS
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccacaaagaccgttcccaggccatggggtctgccgctcatcggcaacgtaccg
agcatagacatgggctaccctcttggaagtctgaatagcctcgcagatcgttacgtagga
gaaatataccagctgaacctcatcggcaaggaggcgctcttcatttcaacccacaagctc
tttgccgaagtctgcgacgagacacgatttcagaagcatcttctagcaccgttggtgcaa
ttgcggaatgtcgtcggtgatggactgtttacagccttccctggtgaaacgaattgggag
atcgcccatcgcacactcatgccagcattcggtcctcttccgatccagtccatgtttgca
gaacagcacgacatcgcttcgcaattagtgctcaagtgggcgagattcggtcccgatcat
gacattgcagtcactgatgacttcacgcggttgaccctggataccattccgctctgctcg
atggatatgagattcaactctttctatcatgacgatctacatccattcgtagacgccatg
gtcggcgttctcgcagcggccggcgaccgagcaaggagacccgatgtcgccgactacgtg
ctccgagcgcaacgagcaaagttcgacaaggacatcgcttacttgcgaaagctgtcgacg
gaacttgtcgcacgacgtcgtgagaagggaactcagaagaaggacttgctgaacgcctta
ctgaacaataaagatcccaagcttggcgttggaatgaccgacgactccatcgtggacaac
atggtaacgtttctcgtggccggccatgaaaccacctctggactgctgtctttcctgttc
tacgagctcacttcaagtccggaggcctacaagaaagcacagcaagaagttgacgaggtc
gtgggctccggcgcagtcaacgtcggccatctttcgaaattgccatatctcacagcttgc
cttcgagagacacttcgcctgcattcgaccgcaccagccatctcagtcacggcattgaag
gacgatataattggtggtcagtatgctgtcaagaaaggacaaggcatcaactgtctgcta
gcaaagatccagtccgatccagcagtctggggcactgacgccagcgagttcaagccggaa
agaatgctggatgagatattcaacaagttgccagcacatgcttggaaacccttcggtaat
ggagttcgagggtgcatcggaagagcattcgcatggcaggaggctttactgacagtcgcc
ttattgttgcaaatcttcaacttccggaagaccgatccatcttacaagctggaagtcgcg
atgacgttgaccatcaagcccaagaacttcacgatgcgtgctactatgcgggatccgagt
attctggagcgactgggcgcggtgtcagtttccggtgaagtttcgtcagcaaaagccacg
actcaacatgcgagaacatcttcgctggctgcagtcgagagcgctggcacgacgatcaat
atcttgtatggcagcaacaccgggacgtgtgagtcactcgcatcatcgctcggatccact
gccaagtcaagaggctacaaggcatatgtggacacgctcgacaacggaatgtcttccata
tctgcggacaagccgacagtcatcatcaccgcaagttatgaagggcagcctccggacaat
gcgatgaagttctccaaatggctgaactctgatgaaagttcgagcttggcgaagagcaaa
tatgccgtttttggtgtgggcaacagggagtgggtaacgacgtatcagcgacagcccaag
ctcattgacgaagtgatgggtcaaaagggagccgagagccttgtcgatcgtggtattgcc
gatgtctgtgacggcgatatcttcaacgctttcgacagatggaccgacgagaaactctgg
ccagcagtcgacgccgctttcagcgcaggcaaatcagccgcatcctcggacgaaggcctc
agcatcaccgtcgacaccgaatctcgcgtcaaacaactacgacaagatgtccaagcagca
gtcgtccaagacgtgaaactgctcacagcacctggcaaacccgcgaaacggcacattcaa
ctcaagctccctcccggcacggactacaaagccggcgactacctcaccgtgctacccgtc
aaccccgaaccctccgttcgccgtgccatggctcgcttcaaactcacctgggacgccacc
ataaccatcgacagcagttcccaaacaaccatccccactggtcgaccaatctcagccttc
gacgtcttcgcatcctacgtcgaactaggtcaacccgcgaccgacaagcaaatctcccaa
ctcgcttccaccatcccagacgaaaaggatcgccagtcccttaccaacacttctctcaaa
cccgccgcgaaaaccaaaaccccttccctcctcgaactcctcgaaacctaccccacagcg
acctatacactctcccaattccttgccgccgttcccagcatgcgcacaaggcaatacagc
atctcctcctccccacttgttgaccccggctccgcatctctcacttactccgtgctcgac
gctcccgccaaccccgcctccccagccgacggcaaacgcttcctaggagtcgcctcgaat
tacatggcacgcgcacaaccaggcgatcacatccaagtcgccctccgaccaagccacgca
ggtttccacctcccctcagacgacagcaaacccgtactcatggcctgcgccggcaccgga
ctcgcgcccttccgcgccttcgtcgaagaacgcgccgtcaaaatcgcagccggcaagaac
ctcggtccagcaatcctcttcttcggctgcaacgcccccgacgaagacgacatgtaccgc
tctgaattcgacgcctggacgaaatccggggccgtggatgtccgcagagcgtacactttc
gcgccggagaagagtgaggggtgtaaattcgtgcagcatcgggtgtggcatgatcgcaag
gagatggtggagttgatccagaaggatgcgtgtatgtatatttgtggagcgggtgtggtg
ggtgcggcgttggtggatgttgtgcagaggatttatgtggagtataaggggtgcacggag
gaggaggcgaagaagtggtttgaggggttgaggggtgagaggtattggagtgatatcttt
tcgtag

DBGET integrated database retrieval system