KEGG   Zymoseptoria tritici: MYCGRDRAFT_70677Help
Entry
MYCGRDRAFT_70677  CDS       T02285                                 

Definition
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00620  Pyruvate metabolism
ztr00630  Glyoxylate and dicarboxylate metabolism
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
ztr01200  Carbon metabolism
Module
ztr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYCGRDRAFT_70677
   00630 Glyoxylate and dicarboxylate metabolism
    MYCGRDRAFT_70677
Enzymes [BR:ztr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MYCGRDRAFT_70677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 13399559
NCBI-ProteinID: XP_003853573
JGI: Mycgr3_70677
UniProt: F9X873
Position
4
AA seq 545 aa AA seqDB search
MPNPVNTEQILQDVNIFGRLNDQTRQILSKDATIFLAVLHRTFNARRKALLERRLVRQAE
LDKGHQLDFLPETAHIRENDAWRGAPPAPGLVDRRLEITGPTDRKMVVNALNADVWTYMA
DFEDSNAPTWDNMINGQLNLHDAIRRQVDFKIGDKDYKLRTDRTLPTLIARARGWHLEEK
HFTVDGEPISGGLFDFGLYFFNNARELVKRGTGPYFYLPKMESHLEARLWNDVFNLAQDY
IGMSRGTIRATCLIETITAAFEMDEIIYELRDHSSGLNCGRWDYIFSVIKRHRQNSQFVL
PDRSAVTMTVPFMDAYVRLLIKTCHRRGVHAMGGMAAQIPIKNDEEANKKAMDGVRADKL
REVRAGHDGTWVAHPALAQIAGEVFNKHMTTPNQLHVRREDVQVNANDLLNMNVPGSITE
DGIRKNLNIGLGYMEGWLRGVGCVPINFLMEDAATAEVSRSQLWQWVRHGVSTDAGKKVD
KQYALRLLYEQAEELQKNGPKGNKYPLAAKYFATQVTGEDYAEFLTSLLYNEITNAGEKT
AASKL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacccagtcaacaccgagcagatcctccaagatgtcaacatctttggccgattg
aacgaccaaacccgccagatcctctccaaggatgccaccatcttcctcgccgtcctccat
cgtaccttcaacgcccgccgcaaggcattgctcgagcgccgcctcgtccgtcaagccgag
ctcgacaaaggccaccagctcgacttcctcccagagactgcacacatccgcgagaacgat
gcatggaggggtgcaccacccgcgccaggtctcgtggaccgcagacttgagatcactgga
ccaacagacaggaagatggttgtcaatgccttgaacgcagatgtgtggacctacatggcc
gactttgaggactcgaatgccccgacatgggacaacatgatcaacggccagctgaacctc
cacgatgcgattcgcaggcaggtggactttaagattggcgacaaggactacaagctccgc
accgaccgtaccctcccgaccctcatcgcccgtgctcgcggatggcacctcgaggagaag
cacttcaccgtcgacggtgagccaatctccggtggtctcttcgacttcggtctgtacttc
ttcaacaatgcccgcgagctcgtcaagcgcggcaccggcccatacttctacctccccaag
atggagagccacctcgaggcaagactgtggaacgatgtgttcaacctcgcacaagactac
attggcatgtcccgaggcaccatccgtgccacctgcctcatcgagaccatcaccgccgcg
ttcgagatggacgagatcatctacgagctccgcgaccactcctccggcctgaactgcggt
cgctgggactacatcttctccgtgatcaagcgtcaccgtcagaacagccagttcgtgctg
cccgaccgctccgccgtgaccatgaccgttcccttcatggacgcctacgtgcgtctgctc
atcaagacctgccatcgccgcggcgtgcacgccatgggtggtatggccgctcagatcccg
atcaagaacgacgaggaggcgaacaaaaaggccatggacggcgtgcgtgccgacaagctg
cgtgaggtccgtgccggacacgacggtacatgggtggctcaccctgcgttggcccagatt
gcgggcgaggtattcaacaagcacatgacgactcccaaccagctccacgttcgtcgtgaa
gacgtccaggtcaacgccaacgacctgttgaacatgaacgtgcccggcagcatcaccgag
gacggaatccgaaagaacttgaacatcggtctcggctacatggagggctggctgcgcggc
gttggttgcgtgccaatcaacttcttgatggaggacgccgctaccgccgaggtgtcccga
tcacagctgtggcagtgggtgcgccacggcgtgtcgaccgatgcgggcaagaaggtcgac
aagcagtacgctctcaggctgctgtacgagcaggccgaggagctgcagaagaacggacca
aagggtaacaagtacccattggctgccaagtactttgctacccaggtcaccggcgaggac
tacgccgagttcttgacatcacttttgtacaacgagattacgaatgcgggcgagaagacg
gcggcttctaagttgtag

DBGET integrated database retrieval system