KEGG   Zymoseptoria tritici: MYCGRDRAFT_72515Help
Entry
MYCGRDRAFT_72515  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ztr  Zymoseptoria tritici
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ztr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ztr00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 524 aa AA seqDB search
MDDHGETSSATTPNPTAPPTPFRLEKAEDRGHNRVPVRMKKHLTIVIKLGTSSIVDEKTH
EPLLSILSTIVETAVSLRHDGHRVVICSSGAIGMALRQMNLPRRPKHLPQVQALAAIGQC
KLMSMWDQLFQHMRQPVAQILLTRNDIADRTQYLNAQNTFVELLNMGVIPIVNENDTLSV
QEIKFGDNDTLSAITAGMVQADYLFLMTDVDCLYDKNPRTHPDALPIEVVSDIADLAADT
SSAGSSLGTGGMSTKIVAARLATAAGVTTVITRSSQPGNISAIVRYVEAQKSTACLANSD
ELPPRAIDPHLQKFAIEHPVNGDHHPPQILPPDLEPPPLHTRFLPDLFPIRDRYFWLLHG
LAPHGTVYIDSGAHTALCSKAGLLPVGVVAVEGSFHQHECVSLKVLPSRDSKLEDGEEVG
KAIVNYSSGEIGRIKGRRSKEIEERLGYADSEYVAWRDCVALYARLGSRPGSPLNGHGSV
NGSRNGAGSANGDAADDGEGIRAELGRRSSERRRMGSLSGFVER
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccatggcgagacctcgtctgctacgactcccaatcctacagcacctcccacg
ccgttccgcttggagaaagctgaggatcgaggacataatcgcgtgccggtcaggatgaag
aagcatttgacgattgtcatcaagctgggcacctcctccatcgtcgacgaaaagacccac
gaacccctcctctccatcctctccaccatcgtcgaaaccgccgtctccctccgccacgat
ggtcaccgcgtcgtcatctgctcctcgggagccatcggcatggccctccgccagatgaac
ctcccccgccgcccaaaacacctcccacaagtccaagccctcgcagcaataggacaatgc
aagctcatgtccatgtgggaccagctcttccaacacatgcgtcaacccgtggcacaaatc
ctgctcacgagaaacgacatcgccgatcgcacgcagtacctcaatgcgcagaatacgttt
gtggaattgttgaatatgggtgtgataccgattgtgaatgagaatgatacactttctgtg
caggagattaagtttggggataatgatacgctgtctgctattacggcggggatggtgcag
gctgattacctctttctcatgacggacgtcgactgcctctatgacaagaatccgaggacg
caccctgatgcactcccaattgaagtggtctccgacattgccgaccttgccgctgatacc
tcctccgctggctcctccctcggcacaggcggcatgtccaccaaaatcgtcgccgcgcgc
ctagccaccgcagcaggcgtgacaaccgtcatcacccgctcctctcaaccgggaaatatc
tccgccatcgtgcggtacgtggaagcacaaaaatccaccgcctgcctcgcaaattcagac
gaactcccaccacgagcaatcgatccgcatctgcagaagttcgcaatcgaacatcccgtc
aacggcgatcatcatcctcctcaaatcctcccgccagatctcgagcctcctccactacac
acccgattcttaccggacttattccccatccgtgaccgctacttctggctcttgcacggt
ctcgcgccgcatggaacggtatacatcgactccggagcccacaccgctctctgttccaaa
gccggcctcctccccgtcggcgtcgtcgcggtagaaggttccttccaccaacacgaatgc
gtctcgctcaaagtcctaccatccagggattcaaaactcgaagatggcgaggaagtgggt
aaagcgatcgtcaactacagttcaggggagatcggaaggatcaagggtaggaggagtaag
gagattgaggagaggttggggtacgcggatagtgagtatgtggcttggagggattgcgtg
gcgttgtatgcaaggttggggtcgaggccgggaagtccgctgaatgggcatgggagtgta
aacgggagtagaaatggtgccgggagtgcgaatggggacgcggcggatgatggggagggg
attagagcggagttgggcaggagatcgagtgagaggaggaggatggggagtttaagtggg
tttgtagagcggtga

DBGET integrated database retrieval system