KEGG   Zymoseptoria tritici: MYCGRDRAFT_72541Help
Entry
MYCGRDRAFT_72541  CDS       T02285                                 

Gene name
THI
Definition
protein disulfide isomerase
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
ztr  Zymoseptoria tritici
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MYCGRDRAFT_72541 (THI)
Enzymes [BR:ztr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MYCGRDRAFT_72541 (THI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 716 aa AA seqDB search
MRTSTLFRLLALPLIGFTTAADPGQDHPAAAPELLGQDNTKAGAKYEGNTASTTDGGASE
GTTFNGKHVPPVTEIDGAALNETIKAGYWMVEFFSPYCKHCKLFAPAWQTTYEFYYASEP
VPQSSGSGESHDDMNSFTRYYDYKFAKVDCVANGDACAEKGILQFPTVVVYKDGKELENR
VGGKSVEEMSQWIEEVLETIRPGSRPPGGPTLPKVGDNSVGEVEKTPVAVDNKEDKSPEK
PAPAAPVVKTTPKVKANPDGQSVSLTEETFDKLVTNTRQPWFVKFYAPWCHHCQAMAPNW
QGMARQMEGKLNVGEVNCDVESKLCKDIKVRSFPTILYFRGGERIEYEGLRGLGDLMSFA
NKAVATIEGVADVTAADFEALEKKEEVIFLYFYDQATTSEDFMALERLVLSLVGHAKLVK
TKDPALNERFKISTWPRLVVSRDGKASYYTALSPRDMRDTRRVLDWMRTVWLPIVPELTA
LNAREIMDGKLVVLGILNRDRKEEFLSAKREIKNAALEWIDKQTQAFQLERQELRDAKQL
RIEEAEDRNDQRALRAAKQIRINMDDIERREVGFAWVDGVFWERWVRTTFGISVADGERV
VVNDERNHRYWDNTMTGNPIVPSRTSILETLPRIVANPPKIPAKLTTNAIGHIWWVFKQQ
VSEHPIVSGGLVVLILGALLWNRRRGAAGGYIRLSEKGGMDGLLGGNSGAAQGKVD
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacatcgaccttgttccgactgctggcattgcctctcatcggcttcaccaccgcc
gcggaccccggacaagaccatccagcagccgcgcctgaattactcggacaggacaacacg
aaggcgggtgcgaaatacgagggcaatacagcctcaacaacagacggtggtgccagcgaa
ggtaccacatttaatggcaagcatgtgcctccggtcacagaaatcgacggagccgcgctc
aatgaaacgataaaggccggctactggatggtcgaattcttcagcccatactgcaagcac
tgcaaactattcgctccggcatggcaaacgacatacgaattctactacgcttccgagccc
gtaccacaatcatccggctccggcgagagtcacgacgacatgaacagctttacgcgatac
tatgactacaaatttgcaaaggtggactgtgttgcgaatggagatgcgtgcgcggaaaag
ggcatcctgcagttccccactgtggtcgtctacaaagatggaaaggagcttgaaaacagg
gttggaggcaagagcgtagaggagatgagccagtggattgaagaggtattggagacaatc
cgtccaggttcgagaccgccaggtggtccgacattgccaaaggttggggataattcggtt
ggagaggtggagaagacgcctgtggcagtggataacaaggaggacaagagccccgaaaag
cctgcgccggcggctccagtcgtcaaaaccactccgaaggtgaaagccaaccccgacggt
cagtctgttagcttaacagaggagacgttcgacaagctggtcacgaatacgcgtcagcct
tggttcgtcaaattctatgcaccgtggtgccaccattgtcaagccatggctcccaactgg
caagggatggcaagacaaatggaaggcaagctcaatgtgggtgaggtcaactgcgatgtc
gagtcaaagctttgcaaggatatcaaagttcgcagctttccgaccatcttatacttccgc
ggcggcgaacgcatcgagtacgagggactccgcggcctcggcgatctaatgagctttgcc
aacaaggctgtagcaaccattgaaggtgtcgccgatgttacggccgccgattttgaggct
ctggagaagaaggaggaggtcatcttcttgtacttctacgatcaggcaactaccagcgaa
gacttcatggccctggaacggctcgtgctcagcttggtgggccacgccaaactggtcaag
accaaggatccagctctgaacgaacgcttcaagatcagcacatggccacgccttgttgtc
agccgtgatgggaaggcttcgtactacactgcgctctcaccacgcgatatgcgtgacact
cggcgagtcctggactggatgaggacagtctggcttcccattgtcccggagctgactgct
ctcaatgctcgagagattatggatgggaagcttgtagtccttggaatccttaaccgcgat
cgcaaggaagagttcctcagcgcaaagcgtgagatcaagaatgccgctctggaatggatc
gataagcagacacaagcgtttcaactcgaaaggcaagaattgcgcgatgcgaagcaattg
cggattgaggaagcggaagaccgcaatgatcaacgtgccctccgggctgccaagcagatc
cgcatcaacatggacgacattgagcgaagagaagtcggcttcgcctgggtggatggcgtg
ttctgggagagatgggtccgcacaacattcggcatcagcgtggcggatggcgaaagggtc
gtcgtcaatgatgagcgcaatcaccgatactgggacaacacgatgactggcaacccaatc
gtgcccagtcgaacttcgatcttggagacacttcccaggattgtcgcaaacccacccaag
atccctgccaagctcaccaccaacgccattggacatatctggtgggtctttaagcaacaa
gtatccgagcatccaatcgtgagtggtggtttggttgtgctgatccttggcgccttgctt
tggaatcggagacgcggagcggcaggaggatacatccgcctgagcgaaaagggcggtatg
gacggtctacttggtggcaactcaggagcagcacaaggaaaggtcgattga

DBGET integrated database retrieval system