KEGG   Zymoseptoria tritici: MYCGRDRAFT_73071Help
Entry
MYCGRDRAFT_73071  CDS       T02285                                 

Gene name
MgFus3
Definition
mitogen-activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MYCGRDRAFT_73071 (MgFus3)
Protein kinases [BR:ztr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   MYCGRDRAFT_73071 (MgFus3)
Exosome [BR:ztr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MYCGRDRAFT_73071 (MgFus3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 356 aa AA seqDB search
MSRTAQQQQQQGSRKISFNVSEQYDIQDVVGEGAYGVVCSALHKPSGQKVAIKKISPFDH
SMFALRTLREMKLLRYFNHENIISILDIQKPKSYETFTEVYLIQELMETDMHRVIRTQEL
SDDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASTEDNQ
GFMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLIL
DVLGTPTMEDYYGIKSRRAREYIRSLPFKKKIPWKAMFPKTSDLALDLLEKLLAFNPTKR
ITVEEALKHPYLEPYHDPEDEPNAEPIPEEFFDFDKNKDNLSKEQLKRLIYEEIMR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagaaccgcacagcaacagcagcagcaaggctcgcgcaagatctccttcaacgtg
tcggagcagtatgatattcaagatgtggtcggagaaggcgcatatggtgttgtctgctcg
gcgttgcacaagccatccggacaaaaggttgcgatcaagaagatttcgccctttgatcac
tccatgtttgcgctccgcacgctccgcgagatgaagctcctccgctacttcaaccacgag
aacatcatctccattcttgacatccaaaagcccaaatcttacgagaccttcaccgaagtc
tacctcatccaggaactcatggagacggacatgcaccgcgtcatccgcacccaggaactc
tcggacgaccactgccaatacttcatctaccagaccctccgcgcgctgaaagccatgcac
tccgccaacgtcctccaccgcgatctcaaaccctccaatctcttgctcaacgctaactgc
gatctcaaagtgtgcgactttggcctggctcgctctgcggccagcaccgaggacaaccaa
ggtttcatgactgaatacgtcgcgactcgttggtaccgtgcacccgagataatgctcacg
ttcaaggagtacacgaaagcgatcgacgtgtggtccgtcggatgcatcctcgccgagatg
ttgagtgggaaacccctcttcccgggcaaagactaccaccatcaactcaccctcatcttg
gatgttctcggcacaccgaccatggaggattactatggcatcaaatctcgtcgcgcgaga
gagtatattagaagtctacctttcaagaagaagattccgtggaaagccatgttccccaag
acgtccgatttggccttggatttgctggagaaactactcgcgttcaatcctactaagaga
atcacggtggaggaggcactcaagcatccatacctcgagccgtaccacgacccggaggat
gagccgaatgcggagcccatcccggaggagttcttcgacttcgacaagaacaaggacaac
ctttcaaaggagcagctgaagcgactgatttacgaagagatcatgcggtaa

DBGET integrated database retrieval system