KEGG   Zymoseptoria tritici: MYCGRDRAFT_73993Help
Entry
MYCGRDRAFT_73993  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
ztr  Zymoseptoria tritici
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ztr00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 291 aa AA seqDB search
MPSFDSAKAYAAQETTFFDDGREIELLHYIYSRSDVESSLRNNPTAILAAIDEFARTKKY
LMNVGEDKGKIVTDLIAEVKPKVMVELGGYIGYSTLLFASTVKNNGGTHYFSLERNPEFG
AVIGSLIALAGLSSFVTISIGSSDASLARLHKSGDLSKIDMMFLDHYKPAYTSDLKLCEE
LGLVGVGSVLAADNVVKPGNPPYLEYVRSSVAEKKKKAAQEASEDGKDGKAPDERFADRA
AKQYANRVAEEKVGVSKGRPELVYESRLVESFEPTGEPVSYILLFSDSLRP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgccctccttcgactccgccaaagcgtacgcggcacaagagaccaccttcttcgacgac
ggccgtgaaatcgaactcctgcactacatctactcccgctccgatgtcgagtcctccctc
cgcaacaaccccaccgccatcctcgccgcgatcgacgagttcgcccgcacaaaaaagtac
ctcatgaacgttggcgaggacaaagggaagattgtaacggatttgatcgcagaggtcaag
cccaaagtcatggtcgaactaggcggctacatcggctactccaccctcctcttcgcctcc
acggtcaagaacaacggcggaacccactacttctccctcgaacgcaaccccgaattcggc
gccgtgatcggctccctcatcgccctcgccggcctctcctccttcgtaaccatctccatc
ggctcctccgacgcctcgctcgcccgtctacacaagtccggcgacctctccaaaatcgac
atgatgttcctcgaccactacaagcccgcgtacacctccgacctcaagctgtgtgaggaa
ttgggtctcgtcggtgtgggaagcgtgctggcggcggataatgtggtgaagccgggaaat
ccgccgtatctggagtatgtgaggagttcggtggcggagaagaagaagaaggctgctcag
gaggcgagtgaggatgggaaggatggtaaggcgccggatgagagatttgcggaccgcgcg
gcgaagcagtatgccaatcgagtcgcggaggagaaggtcggtgtgagtaagggacggccg
gagttggtgtatgagagtcggttggtggagagctttgagccgacgggagagccggtgagt
tatattcttttattctcagattcattgaggccttga

DBGET integrated database retrieval system