KEGG   Zymoseptoria tritici: MYCGRDRAFT_73993Help
Entry
MYCGRDRAFT_73993  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
ztr  Zymoseptoria tritici
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MYCGRDRAFT_73993
Enzymes [BR:ztr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MYCGRDRAFT_73993
Exosome [BR:ztr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MYCGRDRAFT_73993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 291 aa AA seqDB search
MPSFDSAKAYAAQETTFFDDGREIELLHYIYSRSDVESSLRNNPTAILAAIDEFARTKKY
LMNVGEDKGKIVTDLIAEVKPKVMVELGGYIGYSTLLFASTVKNNGGTHYFSLERNPEFG
AVIGSLIALAGLSSFVTISIGSSDASLARLHKSGDLSKIDMMFLDHYKPAYTSDLKLCEE
LGLVGVGSVLAADNVVKPGNPPYLEYVRSSVAEKKKKAAQEASEDGKDGKAPDERFADRA
AKQYANRVAEEKVGVSKGRPELVYESRLVESFEPTGEPVSYILLFSDSLRP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgccctccttcgactccgccaaagcgtacgcggcacaagagaccaccttcttcgacgac
ggccgtgaaatcgaactcctgcactacatctactcccgctccgatgtcgagtcctccctc
cgcaacaaccccaccgccatcctcgccgcgatcgacgagttcgcccgcacaaaaaagtac
ctcatgaacgttggcgaggacaaagggaagattgtaacggatttgatcgcagaggtcaag
cccaaagtcatggtcgaactaggcggctacatcggctactccaccctcctcttcgcctcc
acggtcaagaacaacggcggaacccactacttctccctcgaacgcaaccccgaattcggc
gccgtgatcggctccctcatcgccctcgccggcctctcctccttcgtaaccatctccatc
ggctcctccgacgcctcgctcgcccgtctacacaagtccggcgacctctccaaaatcgac
atgatgttcctcgaccactacaagcccgcgtacacctccgacctcaagctgtgtgaggaa
ttgggtctcgtcggtgtgggaagcgtgctggcggcggataatgtggtgaagccgggaaat
ccgccgtatctggagtatgtgaggagttcggtggcggagaagaagaagaaggctgctcag
gaggcgagtgaggatgggaaggatggtaaggcgccggatgagagatttgcggaccgcgcg
gcgaagcagtatgccaatcgagtcgcggaggagaaggtcggtgtgagtaagggacggccg
gagttggtgtatgagagtcggttggtggagagctttgagccgacgggagagccggtgagt
tatattcttttattctcagattcattgaggccttga

DBGET integrated database retrieval system