KEGG   Zymoseptoria tritici: MYCGRDRAFT_74048Help
Entry
MYCGRDRAFT_74048  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ztr  Zymoseptoria tritici
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ztr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 742 aa AA seqDB search
MAPSFEQLDPETEFEDDEEIDFTDLKEQYEEHMEEGLDTFIVIDGLPKVPADSKGKLVKF
LLRSLTKVGSTKEENVFMPINEETGSSEGFAFVEYETPAQAAAAVKALHATPLDKKHTIA
VNKLTDIERFGREGRIDETYRAPEIPEFEEKEHLRWWLGDEEGRDQFVMYRGDNVGVFWN
EREGQPDQVVDRQHWTESFVQWSPKGTYLTSMHNQGVQLWGGPNWSRQKRFMHPGVNLVD
FSPDERYITTWSHRPMEVDETNPILSIEEDGKNYIIWDVATGKPLRSFVTLDSPGPSVDP
DGNPIKKKIQWPAFKWSADAKYVARLNEGQSISVYELPRMNLLDKTSIKIDGVVDFEWAP
ANPQRASVTDYEQLFCYWTPEMGSNPAKVGLMTVPTKEVVRTRNLFNVSDAKLHWQSEAA
YVCVKVDRHSKSKKSLATNLEIFRVQEKGVPVEVVDNLKETVINFAWEPKGNRFVLITTG
EVPVGSAVPPKTSVSFFAPEKAKGREIGNFKLIRTVDKKNNNAIHWCPNGRFVIVATVLS
QQSFDLDFWDFDFEGTPDEKEKDLTANLQLMNTADHYGVTDIEWDPSGRFVATSASVWKH
RMENGYHLYNFSGQLLREEPIEQFKQWTWRPRPERLISKEEMKAVRKNLKQYAKEFEELD
NAKRSTADKAIIEARRRQLDEWLAWRERTQEELLEERRDLGLPDLSEERHALVIAEEEGA
DQSKVVEEITEEILEETEEILE
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttcattcgaacaactagacccggagacggaattcgaagacgatgaggagatt
gactttacagatctcaaggaacaatatgaggagcacatggaggagggtctggacacattt
atcgtgattgatggtctgcccaaggtgccggccgacagcaagggaaagctggtgaaattc
ttgctccgcagcttgacgaaagtcggcagcacgaaggaggagaatgtcttcatgccaatc
aacgaggagactggaagttccgagggattcgcctttgtcgagtacgaaacacctgcgcaa
gccgccgctgcggtcaaggccctgcacgccactcctctggacaagaagcacaccattgcc
gtgaacaaactcacggacatcgagcgattcggaagagaaggacgaatcgatgagacctac
cgcgcacccgagattcccgagtttgaagagaaggagcacttgcgctggtggttgggagat
gaggagggcagagatcagtttgtgatgtaccgtggtgacaacgtgggtgttttctggaac
gagcgtgaaggacaaccggatcaggtcgtcgaccgtcagcactggaccgagtctttcgtc
cagtggtcaccaaagggcacatatctcacatcgatgcacaaccagggtgtacaactctgg
ggaggtccgaactggtcgagacaaaagcgattcatgcaccctggtgtcaaccttgtcgat
ttctctccggacgaacgctacatcaccacctggtctcaccgtcccatggaggtggacgag
accaaccccattctctcgattgaggaggacggaaagaactacatcatctgggatgttgct
accggcaagcctcttcgttcattcgttactctcgattctcctggcccttctgtcgatccc
gacggtaacccgatcaagaagaagattcagtggcccgcgttcaagtggtctgctgatgcc
aagtatgtcgctcgcttgaacgaaggccaaagcatcagtgtctacgaacttccccgcatg
aacctcctcgacaagaccagcatcaagattgacggtgttgtggacttcgaatgggctcct
gcgaacccacagcgcgccagcgtcaccgactacgaacaactcttctgctactggactcct
gaaatgggctcaaatcccgccaaggtgggtcttatgaccgttcccacgaaggaggtcgtc
cgcacacgaaatctcttcaacgtcagcgatgccaagctccactggcagtccgaagccgca
tatgtctgtgtcaaggtcgaccgccacagcaagtcgaagaagtcgctcgccacaaacctc
gaaatcttccgtgtccaagaaaagggtgtcccagtcgaagtcgtggacaacctcaaggag
actgtcatcaacttcgcatgggaacccaagggcaaccgcttcgttctcatcacaactggc
gaggtacctgtcggttccgctgtacctccaaagacctcagtctcattcttcgcgcctgaa
aaggccaagggacgcgaaattggaaacttcaagctcatccgaacagtcgacaagaagaac
aacaacgctattcactggtgccctaacggtcgcttcgtcattgttgccactgttctgagc
cagcagagcttcgacttggatttctgggactttgactttgagggcacacctgacgaaaag
gagaaggacctcactgctaacctccagctcatgaacactgcggaccactacggcgtgaca
gacattgagtgggacccaagtggtcgattcgtcgccaccagtgccagtgtctggaagcac
cgaatggaaaacggataccacctctacaacttctccggccaacttctccgcgaggagccc
atcgagcagttcaagcagtggacatggcgcccacgtcccgagcgcctcatcagcaaggag
gagatgaaggccgtccgcaagaacctgaagcagtacgccaaggagttcgaagagctcgac
aacgccaagcgcagcactgccgacaaggccatcatcgaggctcgccgcagacaactcgac
gagtggctcgcatggcgcgaacgcacccaggaggaacttctcgaagagcggagagatttg
ggcctgccggacctcagcgaggagaggcatgcattggtcattgctgaggaggaaggcgcg
gatcagagcaaggtggtcgaggagattaccgaggagattttggaggagacggaggagatt
ctcgagtag

DBGET integrated database retrieval system