KEGG   Zymoseptoria tritici: MYCGRDRAFT_74191Help
Entry
MYCGRDRAFT_74191  CDS       T02285                                 

Gene name
MgSUC3
Definition
(RefSeq) putative beta-Fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00052  Galactose metabolism
ztr00500  Starch and sucrose metabolism
ztr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MYCGRDRAFT_74191 (MgSUC3)
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_74191 (MgSUC3)
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MYCGRDRAFT_74191 (MgSUC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 13397511
NCBI-ProteinID: XP_003851072
JGI: Mycgr3_74191
UniProt: F9XG92
Position
7
AA seq 564 aa AA seqDB search
MLPSLLLPVAAALVERTVAQAYTSNTTSVYYAPGVPVDVPVEGDYTDYLRPKVHFSPPRY
FMNDPNGMHRDASGLYHLYYQYNPLTTVAGNQHWGHATSRDLYTWENQKIAIFPPNNYTY
VFSGSAVLDPNNTSGFFPQQSNGVVAIYTLAEYPDGQQGVQSQAIAYSRDDGYTFEPYEG
NPVLDINSTQFRDPYVTWHGETSNWVMVVAYAAEYVIGVFTSPDLKEWTHASNFTKHGYL
GTQYECPNLVHLPMEGQDEPVWMLVISINPGGPRGGSISQYFVGDFNGTHFEPYDSATRF
TDFGKDNYAAQYFNGIAANEPQIALGWASNWQYTQLVPTGLETHGQFRSAMSVPRSHHIA
NVSARGYDLISAIHDISPVIESELAYNSSLGNGSVLVDFSTVESGAIYLEANITGLTSST
LRGTANFTISSSISGEYIQGGINAAGSPGIWIDRGHVGGFDNPYFTDKFSEEGLFGPSTN
GSWSMSLVYDNSVIELFLNGAQAAGTLTFFPNRPLDTLAIYVGGLPDTASSSVAAWGLKN
TWAAQANANGTVVGNVTQIEQARR
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgctcccgagtctgctgctgccagtcgccgccgcgttggtcgaacgaaccgttgctcag
gcgtacacctccaatacaacctcggtctactatgccccaggcgtgcccgtcgatgtgccc
gtcgagggagattacacagactatctgcgcccaaaggtgcatttcagccctccacgatat
ttcatgaatgaccccaacggcatgcaccgcgatgcctcgggactttaccacttgtactat
cagtacaacccactcaccacagtagcgggcaatcagcattggggtcatgccacaagtcga
gatctgtacacctgggagaatcaaaagattgccatcttccctccgaacaactatacgtat
gtcttcagcggctccgctgtcctcgacccgaacaatacctccggtttcttccctcagcag
agcaacggcgtagtggcaatctacacccttgcagagtatcccgacggccagcagggcgtt
caatctcaggcaatcgcgtacagtcgtgatgatggctatactttcgagccgtacgaaggc
aatccggtcctggacatcaactccacccagttcagagacccatacgtgacttggcacgga
gaaacttccaactgggtcatggtggtggcctacgcagctgaatacgtgattggtgtcttt
acctcccctgatcttaaggagtggacgcatgcaagcaactttacgaagcacggatatctc
ggaacacaatacgagtgtccgaaccttgttcatctacccatggagggccaggacgagccc
gtgtggatgctcgtaatctccatcaacccaggtggtcctcgaggaggaagcatatcgcag
tacttcgttggcgacttcaatggcacgcactttgagccatacgatagcgccactcgattc
acagacttcgggaaggacaactacgccgctcagtacttcaatggtatagctgccaatgag
ccacagatcgctctcggctgggcctccaattggcaatacacccagctggttcctaccggc
cttgagacgcacggccaattccgtagtgccatgagtgttccccggtcacaccatatcgcc
aacgtctcagcacgcggctacgacctcatctcggcgattcacgacatctcgcccgttatc
gagtccgaattggcatacaacagtagtcttggtaacggttctgttctggttgatttctcc
acggtcgaatctggcgccatttacctcgaggcgaacatcaccggcttgacttcttccacc
ctgcgcggaaccgccaacttcaccatcagctcttcgatttccggcgagtatattcaagga
ggtatcaacgccgccggcagccccgggatctggatcgatcgtggccacgttggtgggttt
gacaacccgtatttcacggacaaattctccgaagaaggactctttgggccgtccacaaat
ggctcctggagcatgagtctggtgtatgacaactcggtcatagagctgttcttgaacggt
gcgcaggctgcgggtactttgacattcttcccaaatcggccgctggacactctggcgatc
tatgttggtggacttccagacacggcatcgtccagtgtggccgcttggggattgaaaaac
acttgggcggctcaggcaaatgcgaatggtaccgtagtcggcaatgtcacgcagatcgag
caggccaggaggtga

DBGET integrated database retrieval system