KEGG   Zymoseptoria tritici: MYCGRDRAFT_74222Help
Entry
MYCGRDRAFT_74222  CDS       T02285                                 

Definition
glycogen debranching enzyme
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
ztr  Zymoseptoria tritici
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ztr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 1549 aa AA seqDB search
MSPQQITNRTYHLLPLKDDGSPDLPGEPPYIYLAPPTVPHYCIRFQIEGTSSICREGSLW
VNIPPKGESFDRKKFHEYKLVPSFTKSLEIDVPVYCAGAFEFYCSYTPLPPFTTGTPEVP
KPTRTKSHYIDVSPKLHVDDSPLPLDSLSVISVLSKFMGSYPEDFNRHLHGISERGYNMV
HFTPLMMRGDSNSPYSIYDQHTFDKTIFPKGEAQIEEMVKNMEHQLGLLSLTDVVWNHTA
NNSKWLEEHPESGYNIKTAPHLQPAYELDSAFLQFSSRLKSLGLPTKLNNTDDLLRIMDG
AKIHVIGSCKLWEFYVCDAEKDALATVSAWTNGHIDFDGNVPDDIASWQLKGKADWIRNN
CCPGTDRMGERFRRRVVPERGAALLQKLFGRYNSQVNSKADERAAYGTMHKFLNELNLDW
YKEYDNDVAAIMEQVFNRTKYMRLEDNGPKIGEITIQNPLIETYFTRLPVNETTSKHDPD
ELALANNGWVWAADVMRDNAGPKSKVYLRRELIVWGDCVKLRYGSGPEDSPFLWKFMTEY
TQLMAKHFHGFRIDNCHSTPLHVASHMLDAARHVQPNLVVAAELFSGDEKMDFLYCQKLG
ISFLIREAMQCWSTAEMSKLVHINSGRPIGSFEVDDISGTDKPIASEAATNGSTPQGREI
THKIIPSKIHALLMDCTHDNETPVQRRDGRDTLPTSALVAMCASASGSVFGMDELYPQLV
ELVHETRHYTSPYSNGAAMKVGPSEGTGGIKRLMNQLHTIMGKDGYDESFVHHEGEYITV
HRLHPKSRKGYYLIAHTAYPGYGNGNAGFGPQWLTGTKAKLLGAWNLEVDQSEEAKKAAA
NDKVLRGVPSKTKDLRGVTVEARGDDTVISVPSVFPPGSIAIFETWIPGAEHSEGLDKYL
TTSARQAFKDCNLNDINAIMYRADSEEHAMSHGADGVYTVPGIGPLVYCGLQGWWSVLRE
VVNHNDLGHPICNHLREGQWALDYIVGRLDKLVQRQDGIYKNLAAPAEWLRQRCDAIRNV
PSFLLPRCFALIIRTAKKAAHERAIEQMHPNIQHGQRFLKSLAMVSCQVQGYMDNAKLWP
DKLDPSLAAGLPHFAQDWARVWGRDVMIAMRGLLTCTGRYDEAKEHLLAFASIVKHGMIP
NLVNSGKLPRYNSRDSVWFFLQNIQDFVALAPKGSNFLQERVRRRFLPYKDDWFPHDDSR
AYSQTSSIEDVIQECLQRHASGMHFREYNAGSDLDSQMKSEGFNIDIEVDWNNGIIYGGN
EWNCGTWMDKMGDSAKAGNKGHPGTSRDGAPVEITGLLFSCLHWVDGLKSAGKFKYDGVT
KPDGTLITYGAWAAKIRSSFEHHYYVPADPAKFGEYDVDPKIVNRKGIYKDVHRCKKEYR
DYQLRPNFPIAMVVAPELFDPAHAIGALEIADKYLRGPTGMATLDPGDMEYHPDYINSDD
SDNYQTAHGRNYHQGPEWLWPTGFFLRALLKFDLKRRKTKEERVEAFQQVTQRLNGCREM
IHDSPWRGLTELTNRNGSYCGDSCPTQAWSAGCIIDLYDDASRTTMDMQ
NT seq 4650 nt NT seq  +upstreamnt  +downstreamnt
atgtctccccagcaaatcaccaatcgaacctaccacctcctcccactcaaagacgatggc
tctcccgatctgcccggcgagcctccatacatctacctcgcgccgcccacggttccacac
tactgcatccgctttcagatcgaaggtaccagctcgatatgcagagaagggagcctctgg
gtgaacatcccgcccaagggtgagagcttcgaccgcaagaagtttcacgaatacaaattg
gttcccagcttcaccaagtccctcgagattgacgtgcccgtctactgcgccggagccttc
gagttctattgctcctacacgcctctcccgcccttcaccacaggcactcccgaggtgccc
aaacccacacgaacaaagtcccactacatcgatgtctcgcccaagttgcacgtcgacgac
tcgccgcttcctctcgactccctctccgtcatctcagtcctctccaagttcatgggatcg
tatcccgaggatttcaatcgccatttgcacggcatcagcgaaagaggttacaacatggtc
cacttcacaccgttgatgatgcgaggtgacagcaattcgccgtactccatctacgatcag
cacacctttgacaagaccattttccccaaaggcgaagctcaaattgaagagatggtcaag
aacatggaacatcagctcggccttcttagtttgacggacgttgtctggaaccacacggcc
aacaacagcaaatggttggaggaacatcccgaatcgggctacaacatcaagactgctccc
catctgcagccagcctacgaacttgattcggctttcttgcaattctcgtctcggctcaag
tcgctgggtctgccaaccaagctcaacaacaccgacgatctgctccgaatcatggacggc
gccaaaattcatgtcattggaagttgcaagctgtgggagttctacgtgtgtgacgccgag
aaggatgctctcgctacagtctcggcatggaccaacggacacatcgattttgacggcaac
gttccagacgatattgcctcctggcaactcaagggaaaggcggattggattcggaacaac
tgctgtccaggaacagaccgcatgggggagcgatttcgtcgccgtgttgtgccagaacgc
ggagctgctcttctgcagaagctattcggccggtacaattcccaggtcaacagcaaggct
gatgagcgtgctgcgtacggcaccatgcacaaattcttgaatgagctcaacctcgactgg
tacaaggagtacgacaacgatgttgccgccatcatggagcaggtcttcaaccgtaccaag
tacatgcgcctggaagacaatggtcccaagattggcgaaatcaccatccagaacccactc
atcgagacatacttcactcgcctgccagtcaacgagacgacttcgaagcacgaccctgat
gagcttgcattggccaacaatggctgggtgtgggctgccgatgtcatgcgtgataatgct
ggtcccaaatccaaggtctacctccggcgcgaactgatcgtttggggtgactgtgtgaag
ctgcgttatggctccggtccggaggacagcccgttcctgtggaagttcatgaccgagtac
acccaactcatggcgaagcactttcacggtttccgcattgacaactgccattccactccc
ctccacgtcgcctctcacatgctcgacgctgctcgccatgtccagcccaacctagtcgtg
gccgccgagctgttcagcggtgacgaaaagatggacttcctctactgccaaaaattgggc
atctccttcctcatccgcgaggccatgcagtgctggtcgactgctgaaatgtccaagttg
gtgcacatcaactctggtcgtcctatcgggagctttgaggtcgatgacatctccggcacc
gacaagccgattgccagcgaagctgcgaccaatggcagcactcctcaaggacgcgagatc
acccacaagatcattccctccaagatccacgccctgttgatggactgcactcatgacaac
gagactccggtgcagcgccgcgatggtcgtgacacccttccaacctctgcattggtggcc
atgtgcgcatccgcttcaggctccgtctttggtatggatgagctgtacccgcaattagtc
gagcttgttcacgaaacccgccattacacctctccctacagcaacggagccgccatgaag
gtcggtccttctgaaggcactggtggcatcaagcgcttgatgaatcagctgcacaccatc
atgggcaaggacggctacgacgagagctttgtgcaccacgagggcgaatacatcactgtc
caccgtctccaccccaagtcgagaaaaggatactacctcatcgcccacactgcctaccct
ggctacggcaatggtaacgctgggttcgggccgcaatggcttactgggaccaaagcgaag
ctcctcggcgcgtggaatctcgaggtcgatcaaagtgaggaggccaagaaggctgccgcc
aacgacaaggtcttgcggggtgtacccagcaagaccaaggacctgcgcggtgtgactgtc
gaggctcgcggggacgataccgtcatctctgtgccgagcgtgttcccacccggctccatc
gccattttcgaaacttggattcccggcgccgagcacagcgaaggtctggacaaatacctc
accactagtgcccgccaggctttcaaggactgcaatctcaacgacatcaacgccatcatg
tatcgcgccgactccgaggagcacgccatgtctcacggtgccgatggcgtgtacacagtt
ccaggcataggtcctctggtgtactgtggactgcaaggttggtggtctgttcttcgcgag
gttgtcaaccacaacgatctcggccacccgatctgcaatcacctccgcgagggtcagtgg
gcgctggactacattgtcggtcgcttggacaagctcgtacaacgtcaagacggcatctac
aagaatcttgcagctcctgcagaatggcttcgacagcgatgtgatgccatccgcaacgtt
ccaagctttctgctcccccgctgcttcgccttgatcatccgcactgccaagaaggccgct
cacgagcgcgccattgaacagatgcaccccaacatccagcacggccaacgtttcctcaag
tcgctcgccatggtttcttgccaagttcaaggatacatggataatgctaagttgtggcca
gacaagctcgatccctctttggctgccggtctgccgcatttcgcgcaagactgggctcgt
gtgtggggtcgcgatgtcatgattgccatgcgtggacttctcacctgcaccgggcggtac
gatgaggccaaggagcatctgctcgctttcgccagcattgtcaagcacggcatgatcccc
aacttggtcaactctggcaagctcccccgttacaacagcagagactcggtttggttcttc
ctgcagaacatccaagacttcgtcgccctcgcacccaaaggatcgaattttctccaggag
cgcgtgcgtcgccgcttcctgccatacaaggacgactggttccctcacgatgactctcgt
gcatactcgcagaccagcagcatcgaagatgtcatccaggaatgtctgcagcgccacgct
tctggcatgcacttccgcgagtacaatgctgggtccgacctcgacagccagatgaagtcg
gaaggtttcaacatcgacatcgaggtcgactggaacaacggcatcatctacggtggcaac
gagtggaattgcggcacatggatggacaagatgggagattctgccaaggctggcaacaaa
ggccacccaggtacttcccgagacggcgcgccagtggaaataaccggtctactgttcagc
tgtctgcactgggtcgatggcttgaagtccgccggcaagttcaagtacgatggtgttacc
aagccggacggaactctgatcacctatggtgcttgggcagcgaagattcgcagcagcttc
gaacaccactactacgttccagctgatcctgccaagtttggcgagtatgatgtcgaccca
aagattgtcaaccgcaagggcatttacaaggacgtgcaccgttgcaagaaggagtaccga
gactaccaattgcgaccgaatttccccatcgccatggtcgttgctccggagctcttcgat
ccagcgcacgccattggcgccctggagattgccgacaagtacctgcgtggacctacgggt
atggcgaccctcgatcctggcgacatggagtaccaccccgactacatcaacagcgacgac
agcgacaactaccagactgctcatggacgcaactaccaccaaggaccggagtggttgtgg
cctaccggattcttccttcgtgctctgctcaagttcgatctcaagcgtcgcaagaccaag
gaggagcgtgtcgaggccttccagcaggtcactcagcgccttaatggctgtcgtgagatg
atccacgactctccgtggcgaggtctcactgagcttaccaaccgcaatggctcttactgc
ggtgactcgtgcccaactcaggcttggtccgcagggtgcataatagacctctacgacgat
gcgagccggacgacgatggacatgcaatga

DBGET integrated database retrieval system