KEGG   Zymoseptoria tritici: MYCGRDRAFT_74660Help
Entry
MYCGRDRAFT_74660  CDS       T02285                                 

Definition
glycogen synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ztr  Zymoseptoria tritici
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_74660
Enzymes [BR:ztr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MYCGRDRAFT_74660
Glycosyltransferases [BR:ztr01003]
 Polysaccharide
  Storage polysaccharide
   MYCGRDRAFT_74660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 722 aa AA seqDB search
MGEPQHRDVRNHVLFEIATEVANRVGGIYSVLKSKAQVTTAEYGSMYTLLGPLNRASAAV
EVEEIEPRDPAMINTIKSMNDRGIKTLYGRWLIDGAPRVLLFDTSTGYYKLDEWKGDLWS
TAGIPSPPDDHETNEAIVFGYLIAWFLGEYVYHEKERAVIAQFHEWLAGVALPLCKKRKI
DVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERGAAHSADVFT
TVSHITAYESEHLLKRKPDGVLPNGLNVKKFSATHEFQNLHQVNKERITEFIRGHFYGHN
DFDPDKTLYLFTAGRYEYRNKGVDMFIESLARLNHRMKSAGSDMTVVAFIIMPAQTTSLA
VEALKGQAVIKSLRDSVDHIEKSVGKKLFEKALAWHEGAEVPDEKDLITAQDKIMLRRRL
FAMKRNTLPPIVTHNLVNDAEDPILNQIRRCQLFNHPSDRVKVIFHPEFLSSGNPVLPMD
YDDFVRGTHMGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENAQDYGIYI
VDRRMKGVDDSVNQLAEFMYQFTQKSKRQRINQRNRTERLSDLLDWKRMGMEYVKARQLA
LRRAYPDSFDSATDDEPGFFDGTESMKISRPLSAPGSPRERSGMMTPGDFASLQEGREGL
STEDYIAWKLPEEEEPEDYPFPLTLKTKKGDGSGATTPTMTNGNGNVALPDRGVLASAST
IQ
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaccacagcaccgcgacgtgcgcaaccatgtgctcttcgaaatcgctaccgag
gtcgccaaccgtgtcggaggtatctacagcgtgctgaagtcgaaagcacaagtcaccacc
gcagaatatggctccatgtacaccctgctcggtcctctcaaccgcgcttcggccgccgtc
gaggtcgaagaaatcgagccaagagatcccgccatgatcaacaccatcaagagcatgaat
gacaggggaatcaagacactgtacggaagatggctgattgatggtgctcctcgtgtgttg
ctcttcgacaccagcacgggttactacaagctggacgagtggaagggcgatctttggtcg
acggctggcattcccagcccgccagatgatcacgagacgaacgaggccattgtgtttgga
tatctcattgcgtggttcttgggcgagtacgtctaccacgagaaggaaagggctgtcatt
gcacagttccacgagtggctggccggtgttgctctccccttgtgtaagaagcgcaagatt
gatgtgactaccatcttcaccacccacgctacccttctcggacgctacctctgcgccggc
tccgtcgatttctacaacaacctgcagtactttgacgtggacgccgaggctggaaagcgt
ggtatctaccaccgatactgcatcgagcgtggtgccgctcacagcgctgatgtgttcacc
accgtcagccatatcacggcatacgagagtgagcacctgctcaagcggaaacctgatggc
gtccttcccaacggtctgaacgtgaagaagttctccgctacccacgagttccaaaacttg
caccaggtcaacaaggagcgcattactgagttcattcgaggacacttttacggtcacaat
gatttcgatcccgacaagacgctgtacctcttcaccgctggtcgctacgaataccggaat
aagggcgtggacatgttcatcgagtcgctggctcggttgaatcaccgaatgaagagcgcg
gggtcggatatgacagtcgttgcattcatcatcatgcccgcgcaaaccacatctcttgct
gttgaggcattgaagggacaggctgtgatcaaatctctgcgcgattccgttgatcacatc
gagaagagtgtgggcaagaagcttttcgagaaggctcttgcatggcacgagggtgctgag
gtgcctgacgagaaggacctcatcacggctcaggacaagatcatgctgaggagacgcctc
ttcgccatgaagcgcaacactcttccaccgatcgtcacgcacaatttggtcaacgatgcc
gaggacccgattctcaaccagatccgtcgctgccagcttttcaaccacccatccgatcgt
gtcaaggttattttccaccccgagttcttgtcctccggcaacccggtcctcccaatggac
tacgacgatttcgtccgcggtacgcatatgggtgttttcagctcatactacgagccgtgg
ggctacactcccgccgagtgtaccgtcatgggtgttccgtccatcaccaccaacttgtcc
ggatttggatgctacatggaggaactgatcgaaaatgctcaagactacggcatctacatc
gtcgaccgcaggatgaagggtgtcgatgactccgtcaatcaactcgcggagttcatgtac
caattcacacaaaagagcaagcgtcaacgcatcaaccagcgtaatcgcacggagcgattg
agcgatctgctcgactggaagaggatgggcatggaatacgtgaaggcgagacaattggct
ttgaggagagcgtacccggatagcttcgacagcgcgacggatgacgagcccggtttcttc
gacggcaccgagagcatgaagatttcgaggcctttgtctgcgcctggtagcccgagggag
agaagcggcatgatgactcctggtgactttgcttcgctgcaagaagggcgggaaggattg
agcacggaggattacattgcgtggaagttgcccgaggaggaagagccggaagactacccc
ttcccactcacgctcaagacgaaaaagggcgacggatccggcgccacgacacccaccatg
actaacgggaatggcaatgttgcgttgccggatcggggcgtgttggcgagtgcgagtacg
attcagtag

DBGET integrated database retrieval system