KEGG   Zymoseptoria tritici: MYCGRDRAFT_74800Help
Entry
MYCGRDRAFT_74800  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
ztr  Zymoseptoria tritici
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MYCGRDRAFT_74800
Translation factors [BR:ztr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    MYCGRDRAFT_74800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 354 aa AA seqDB search
MEKGTDNSPSNLWTRRSNSSKISLSTNKSDRNDTTDSAPGSKRFGTSSSHGKNNTFNSIG
SISTSAVASPTSAGASSAFGLGSGAFASFGNAGKTPKTPGSSIDLSKQASEKKDSSEEQA
KDTRRPPARKSASALRQPSSAVDTTTQQSSKDVVGGWPLKNGWVIYYRPPTNKNSDYEKS
IKPLCKVQSAQAFWTVYTHLKRPSDLPTVSDYHIFREGIRPVWEDEENKRGGKWTMRLKK
GVADRYWEELLLALVGDQFVEAGEEVCGAVVSVRQGEDVFSIWTKNDGGRNIKIRETIKR
VLNLPADTNLQWRSHDESITQRHAVDQARQEKANQDKRRSTLGNEKEGGEQSKA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggagaagggtactgacaacagcccgtcgaatctctggacccgtcgatcgaacagcagt
aaaatcagcctttccacgaacaaatccgaccgcaacgataccacagactctgcccccggt
agcaaaagatttggcacatcaagtagccacgggaagaataatacgttcaactcgatcggt
agcatctccaccagtgcggtagcctctccgacgagcgccggggcttcgtctgcattcgga
ttgggtagcggagccttcgcaagctttggaaacgctggcaagacacccaaaacgcctgga
tcctcgattgaccttagcaaacaagcgagcgagaagaaggattcgtcagaggagcaagcc
aaggacactcgaagaccgcctgcacgcaagtctgcgtcggctctgcgtcaacccagctct
gcagtagacacaacaacacaacaatcctcgaaagatgttgtaggaggctggccgcttaag
aacggttgggtgatctattaccgtcctcctacaaacaagaacagcgattacgagaagtct
atcaagcctctctgtaaggtgcagtctgcgcaggcgttctggacagtgtacacacatctc
aagcgacccagcgatcttcccacggtcagcgactatcacattttcagagaaggcatacgt
ccggtgtgggaggatgaggagaacaagcgcggtggaaagtggacaatgcgtttgaagaag
ggcgtcgcggataggtactgggaggagcttcttctggcgcttgtcggcgaccaatttgtg
gaagctggcgaggaggtctgcggtgctgttgtcagtgtgcgccagggcgaggatgtcttc
tccatctggaccaagaacgacggcggtcgcaacatcaagattcgagagactatcaagcgt
gtgctcaatctgccggcggataccaaccttcagtggcgcagccacgacgagagtattacg
cagcgacatgccgtggatcaggcccgccaggagaaggccaaccaggacaagcgccgtagc
actcttggaaatgaaaaggagggaggagagcagtccaaggcgtag

DBGET integrated database retrieval system