KEGG   Zymoseptoria tritici: MYCGRDRAFT_75758Help
Entry
MYCGRDRAFT_75758  CDS       T02285                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00260  Glycine, serine and threonine metabolism
ztr00750  Vitamin B6 metabolism
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
ztr01230  Biosynthesis of amino acids
Module
ztr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MYCGRDRAFT_75758
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MYCGRDRAFT_75758
Enzymes [BR:ztr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MYCGRDRAFT_75758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 13402435
NCBI-ProteinID: XP_003849474
JGI: Mycgr3_75758
UniProt: F9XJL5
Position
9
AA seq 560 aa AA seqDB search
MVSPKASQRYLSTRGGSYDLSFEEVVLKGLAHDGGLFIPEDIPSLPSDFLTKWRDYSFQE
LAYEIFSLYISPEEIPADDLKDIIHRSYATFRADNIVPLVTLDKEKNLHLLELFHGPTFA
FKDVALQFVGNLFEYFLVRRNKEKEGKSRDHLTVIGATSGDTGSAAIYGLRGKKDVSVFI
MYPKGKVSPIQEAQMTTVTDANVHNIAVEGTFDDCQDILKTLFAEPEINKTLRLGAVNSI
NWARILAQITYYIHSYFSLARQTNTEKPIARFVVPTGNFGDILAGYFATRMGLPADKLVI
ATNENDILDRFWKSGRYEKQAKHGEEAEGGFKADGALADPSGVKMTYAPAMDILVSSNFE
RLLWYLAFRTSDTEEVNRRRMEAGEKVKGWLEQLKKEGGFGVEKAILEAAKEDFESERVS
DSETIDTIKDVYRQKGVPAATNGTTKPATTGMVHDGHYILDPHSAIGIAASLRSIETTKS
RKDIHHIALATAHPAKFSNAVELALKEEEGFSFETVLPEQFQGLMDLEKRITESKASWEA
VRDIVVKQVEEELKGERSTL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggtctcccccaaagcctctcagcgctacttgagcacgcgaggcggctcatacgatctt
tccttcgaagaggtcgtcttgaaaggcctcgcgcacgatggcggccttttcatccccgaa
gacatcccttctctcccatccgacttcctcaccaaatggcgcgactactccttccaagaa
ctggcctacgagatcttctccctgtacatctcccccgaggagattcccgccgacgacctg
aaagacatcattcaccgcagctatgcgacattccgcgctgataatatcgtcccactggtg
acattggacaaagagaagaacctgcacttgttggagctgtttcacggcccgacgttcgca
ttcaaggatgttgcgctgcaattcgtgggcaatctgttcgagtacttcctcgtacgacgg
aacaaggagaaggagggcaagagcagagaccatcttacagtcattggtgctacaagtgga
gatactggctctgcggccatttacggcttgcgaggcaagaaggatgtgtcggtcttcatc
atgtacccaaagggtaaagtgagcccaattcaggaggctcagatgaccacagtcacggat
gcgaacgttcacaacattgccgtggagggcacatttgacgattgtcaggacatcctcaag
acactcttcgccgaacccgagatcaacaagacactccgtctcggagctgtcaacagcatc
aattgggctcgcattctggcccagatcacgtactacatccattcctacttctccctcgcc
cgacagaccaataccgagaagcccattgcacgtttcgtggtcccgaccggcaactttggc
gacattctcgcaggatactttgcgacacgcatgggcctgccagcagacaagctggtcatt
gctaccaacgagaacgacattctggaccgtttctggaagtccggccgttatgaaaagcag
gccaaacacggtgaggaggcagagggtgggttcaaggcggatggtgctctcgcagatcca
agcggcgtgaagatgacatatgctccggcaatggatattctggtcagctcaaactttgag
aggttgctgtggtatctggctttccgcacaagtgataccgaggaggtcaacaggcgacgg
atggaggcgggagaaaaggtcaagggctggttggaacaattgaagaaagaaggtggattt
ggagtggaaaaggccatactggaggctgcaaaggaggacttcgagagcgaacgtgttagc
gattcggagaccatcgacacgatcaaggacgtctacaggcagaagggggtgcctgctgcg
acaaatggaaccacaaagccggctaccactggaatggtccacgatggccactacatcctg
gatccacactcggccatcggtattgctgcgtctctccgctccatcgagaccaccaagtcg
cggaaagacatccaccatatcgccttggctacagcacatcccgcgaagttctctaatgct
gtcgagctggcactgaaggaagaggaggggttctccttcgaaactgttctgccggaacaa
ttccagggtcttatggacctggagaagcgcatcacggagagcaaggccagctgggaggct
gtccgggatattgtggtcaaacaagtggaggaggagttgaagggcgagcgctcgacgttg
tga

DBGET integrated database retrieval system