KEGG   Zymoseptoria tritici: MYCGRDRAFT_75758Help
Entry
MYCGRDRAFT_75758  CDS       T02285                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ztr  Zymoseptoria tritici
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ztr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ztr00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ztr00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 560 aa AA seqDB search
MVSPKASQRYLSTRGGSYDLSFEEVVLKGLAHDGGLFIPEDIPSLPSDFLTKWRDYSFQE
LAYEIFSLYISPEEIPADDLKDIIHRSYATFRADNIVPLVTLDKEKNLHLLELFHGPTFA
FKDVALQFVGNLFEYFLVRRNKEKEGKSRDHLTVIGATSGDTGSAAIYGLRGKKDVSVFI
MYPKGKVSPIQEAQMTTVTDANVHNIAVEGTFDDCQDILKTLFAEPEINKTLRLGAVNSI
NWARILAQITYYIHSYFSLARQTNTEKPIARFVVPTGNFGDILAGYFATRMGLPADKLVI
ATNENDILDRFWKSGRYEKQAKHGEEAEGGFKADGALADPSGVKMTYAPAMDILVSSNFE
RLLWYLAFRTSDTEEVNRRRMEAGEKVKGWLEQLKKEGGFGVEKAILEAAKEDFESERVS
DSETIDTIKDVYRQKGVPAATNGTTKPATTGMVHDGHYILDPHSAIGIAASLRSIETTKS
RKDIHHIALATAHPAKFSNAVELALKEEEGFSFETVLPEQFQGLMDLEKRITESKASWEA
VRDIVVKQVEEELKGERSTL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggtctcccccaaagcctctcagcgctacttgagcacgcgaggcggctcatacgatctt
tccttcgaagaggtcgtcttgaaaggcctcgcgcacgatggcggccttttcatccccgaa
gacatcccttctctcccatccgacttcctcaccaaatggcgcgactactccttccaagaa
ctggcctacgagatcttctccctgtacatctcccccgaggagattcccgccgacgacctg
aaagacatcattcaccgcagctatgcgacattccgcgctgataatatcgtcccactggtg
acattggacaaagagaagaacctgcacttgttggagctgtttcacggcccgacgttcgca
ttcaaggatgttgcgctgcaattcgtgggcaatctgttcgagtacttcctcgtacgacgg
aacaaggagaaggagggcaagagcagagaccatcttacagtcattggtgctacaagtgga
gatactggctctgcggccatttacggcttgcgaggcaagaaggatgtgtcggtcttcatc
atgtacccaaagggtaaagtgagcccaattcaggaggctcagatgaccacagtcacggat
gcgaacgttcacaacattgccgtggagggcacatttgacgattgtcaggacatcctcaag
acactcttcgccgaacccgagatcaacaagacactccgtctcggagctgtcaacagcatc
aattgggctcgcattctggcccagatcacgtactacatccattcctacttctccctcgcc
cgacagaccaataccgagaagcccattgcacgtttcgtggtcccgaccggcaactttggc
gacattctcgcaggatactttgcgacacgcatgggcctgccagcagacaagctggtcatt
gctaccaacgagaacgacattctggaccgtttctggaagtccggccgttatgaaaagcag
gccaaacacggtgaggaggcagagggtgggttcaaggcggatggtgctctcgcagatcca
agcggcgtgaagatgacatatgctccggcaatggatattctggtcagctcaaactttgag
aggttgctgtggtatctggctttccgcacaagtgataccgaggaggtcaacaggcgacgg
atggaggcgggagaaaaggtcaagggctggttggaacaattgaagaaagaaggtggattt
ggagtggaaaaggccatactggaggctgcaaaggaggacttcgagagcgaacgtgttagc
gattcggagaccatcgacacgatcaaggacgtctacaggcagaagggggtgcctgctgcg
acaaatggaaccacaaagccggctaccactggaatggtccacgatggccactacatcctg
gatccacactcggccatcggtattgctgcgtctctccgctccatcgagaccaccaagtcg
cggaaagacatccaccatatcgccttggctacagcacatcccgcgaagttctctaatgct
gtcgagctggcactgaaggaagaggaggggttctccttcgaaactgttctgccggaacaa
ttccagggtcttatggacctggagaagcgcatcacggagagcaaggccagctgggaggct
gtccgggatattgtggtcaaacaagtggaggaggagttgaagggcgagcgctcgacgttg
tga

DBGET integrated database retrieval system