KEGG   Zymoseptoria tritici: MYCGRDRAFT_75805Help
Entry
MYCGRDRAFT_75805  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     MYCGRDRAFT_75805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 693 aa AA seqDB search
MASLDTLDIVVLAILLLGTIAYFTKGTYWAVPPKDPYASLTNGSAKAGKSRDILEKLEET
GKNCVIFYGSQTGTAEDYASRLAKEGSSRFGLKTMTADLEEYDYENLDKFPDDKVAFFVL
ATYGEGEPTDNAVEFYEFIGGEDVSFSEKSAEESPLGGMKYVTFGLGNNTYEHYNSMVRN
VDKYLTRLGAQRIGEAGEGDDGAGTMEEDFLAWKEPMWNALAEAMNLEEREAVYEPVFEV
TEKENMDASHDTVYLGEPNKNHLEGKSKGPYNAHNPYIAPIAESYELFHDKSRNCLHMEI
DISGSNLSYTTGDHIAVWPNNPGREVERLLKVTGLKKKADTVITVKGMDATAKVPFPTPT
TYDTVFRYQLEICAPVSRQFVATLAQFSPNDEIKEKMTKIGGDKETFSAEVAKKNFNIAQ
FLEHIGNGQTWDKIPFALFVESLNKIQPRYYSISSSSLVQKNKVSITAVVDSVAVPGAPH
IVKGVTTNYLLSLKLKQEGQSNPDPHGLNYAITGPRNKYDGVHVPVHIRHSNFKLPSDPS
KPIIMVGPGTGVAPFRGFVQERAQQAKNGEKVGKTLLFTGSRSRKEDFMYEKEWEQYTKD
LDGQFELITAFSRESDKKVYVQHRLKERAEEVNKLLEQKAYFYVCGDAANMAREVNETLS
TIISEQRGVEKKKAEDVVKGMRSGNLYQEDVWS
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggcctccctcgacacgctggacatcgtcgtcctggccatcctcctcctcggaaccatc
gcatacttcaccaaaggcacatactgggcagtcccaccgaaggacccgtacgcgtctctc
acaaatggatccgccaaggcaggcaagagcagggacattcttgaaaagctggaagagacg
ggcaagaactgtgtcatcttctacggctctcagacaggaacggccgaagattatgcttct
cgcctcgccaaggagggttcatcgcgttttggattgaagaccatgaccgccgatttggaa
gagtacgattacgagaacttggacaagtttcctgatgacaaggttgcttttttcgtgttg
gccacctatggcgagggcgagcctaccgacaatgctgtggagttttacgaattcatcggc
ggggaggatgtctcattcagcgagaagagcgccgaagagtctcctttgggcggcatgaaa
tatgtcactttcggccttggaaacaatacttacgagcactacaactccatggttcgaaat
gtcgacaagtaccttacgcgactcggcgctcagcgtattggagaggctggtgagggcgat
gatggtgccggcactatggaggaggatttcctggcctggaaggagcccatgtggaacgca
cttgcagaggctatgaacttggaagagcgcgaggccgtctacgagcccgtttttgaggtt
acagagaaggagaatatggacgcttcccacgatacggtctacctaggcgagcccaacaag
aatcatcttgaaggcaagtcaaagggtccctacaacgcacacaacccgtacatcgcaccc
atcgccgagtcatacgagctcttccacgataaatcacgaaactgcctgcacatggagatt
gacatttccggatcgaacctgtcctacactactggtgatcatattgctgtttggcccaat
aaccccggccgcgaggtggaacggttgctgaaggttactggattgaagaagaaggcagac
actgtgatcaccgtcaagggtatggatgccaccgccaaagttcctttccctacgccgact
acctacgacactgtcttccgctaccagctggaaatttgcgccccagtctctcgacagttc
gtcgctactcttgcccagttctctcccaacgatgaaatcaaggagaaaatgacaaagatt
ggcggtgacaaggagaccttttccgccgaagtcgccaagaagaatttcaacattgcgcaa
ttccttgagcacatcggcaatggtcaaacgtgggataagattccatttgctctttttgtc
gagtctttgaacaaaatccaaccccgatactactccatctcgtcctcatctcttgttcag
aagaacaaggtctccatcactgccgtggtcgactcggttgcggttcctggtgcgcctcac
atcgtcaagggtgttacaacaaattacctactctctctcaagctcaagcaggaaggccag
tccaaccccgatccacatggtcttaactacgccatcaccggtcctcgaaacaagtacgat
ggcgtccacgttcctgttcacattcgtcattccaacttcaaacttccgtcagaccctagc
aagccgatcatcatggtcggaccgggaactggtgttgcaccattccgaggattcgtccag
gagcgtgctcagcaagcgaagaacggcgagaaggttggcaagacactactgttcaccggc
agcagaagtcgcaaggaggacttcatgtatgaaaaggagtgggagcaatatactaaagac
ctcgacggtcaattcgagctcatcaccgccttttcccgcgaaagcgacaagaaggtgtac
gtccaacaccgcctgaaggagcgtgccgaggaagtcaacaagctgttggagcagaaggcg
tacttttatgtgtgcggtgacgcggcgaacatggcacgagaggtcaatgagactctgtcg
acaatcatcagtgagcaacggggtgttgagaagaagaaggccgaggatgtggtcaagggc
atgaggagtgggaatttgtaccaggaggatgtctggtcgtag

DBGET integrated database retrieval system