KEGG   Zymoseptoria tritici: MYCGRDRAFT_75993Help
Entry
MYCGRDRAFT_75993  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MYCGRDRAFT_75993
Peptidases [BR:ztr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   MYCGRDRAFT_75993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 328 aa AA seqDB search
MSGGWNTIESDAGLFTSMMEELKVENVQFEELISLDEDSLQQLNPIGVIFLFKYQTDEKR
SKDTPLDGEFDYAALEYKDDEEPVWFAAQTIQNACGTQALLSVLLNKDGTQEEGKVNIGP
NLKEFKEFTSAFPSDLRGEALSNSDLIRSVHNSFARSSPFVSDETRMATSSDDVYHFIAY
TSINSTLYELDGLQPAPIRHGDVGACPSEIFASSVIPVLQRRIERYPQTEIRFNLLAMCE
DLRSRAREVGDEEWLMREEAKRREWRWENALRRHNFVGFIAEVMKGVTGQKLKEGKYDAW
VEDAKKVTSKRMEERQKKGEAPDEMDMS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcggttggaacaccatcgagtccgatgccgggctcttcacgagcatgatggaa
gagctgaaagtcgaaaacgtacaattcgaagagctcatctcgctcgacgaagattccctg
caacagctcaaccccatcggcgtcatcttcctcttcaaataccaaacagacgagaaacgc
agcaaagatacacccctcgacggcgaattcgactatgcagcactggaatacaaggacgac
gaagagcccgtgtggttcgccgcacaaacgattcaaaacgcctgcggcacacaagcacta
ctcagcgtgctcttgaataaagatgggacacaggaagaaggcaaagtgaacattggccca
aatctgaaggagttcaaagaattcacctccgccttcccctccgacctccgcggcgaagcc
ctctccaactccgacctaatccgctccgttcacaactccttcgcccgctcctcgcccttc
gtctccgacgaaacccgcatggccacctcctccgacgacgtctaccacttcatcgcctac
accagcataaactccaccctctacgagctcgacggtctccagcccgcaccaatccgacat
ggcgacgtgggtgcttgcccttccgagatcttcgcatcttccgtgatcccggtactgcag
cgacgcattgagcgatatccgcagacagagatacgattcaatctattggccatgtgtgag
gatttgaggagtcgagcgagggaggttggagatgaggagtggttgatgagggaagaggcg
aagaggagggagtggaggtgggagaatgcgttgaggagacataatttcgtggggttcatt
gcggaggtgatgaagggtgtgacgggccagaagttgaaggagggaaagtacgatgcgtgg
gtggaggatgcgaagaaggtgacgagtaagaggatggaagagaggcagaagaagggcgag
gcgccggatgagatggatatgtcgtga

DBGET integrated database retrieval system