KEGG   Zymoseptoria tritici: MYCGRDRAFT_76502Help
Entry
MYCGRDRAFT_76502  CDS       T02285                                 

Gene name
MgHog1
Definition
MAP kinase
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ztr  Zymoseptoria tritici
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    MYCGRDRAFT_76502 (MgHog1)
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MYCGRDRAFT_76502 (MgHog1)
Protein kinases [BR:ztr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   MYCGRDRAFT_76502 (MgHog1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 357 aa AA seqDB search
MAEFVRAQIFGTTFEITSRYTDLQPVGMGAFGLVCSAKDQLTGQAVAVKKIMKPFSTPVL
SKRTYRELKLLKHLKHENVISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITDLLGTPPDDVIST
ICSENTLRFVQSLPKRERQPLKNKFKNADPQAIELLERMLVFDPRKRVKAGEALADPYLS
PYHDPTDEPEAEEKFDWSFNDADLPVDTWKIMMYSEILDYHNVDSANNGEGQENGGA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattcgtgcgtgcgcagatcttcggcacgacctttgagatcacgagccgatac
accgatcttcaacccgtcggcatgggcgccttcgggctggtatgctcggcaaaagatcag
ctcaccggccaggccgttgccgtgaagaagatcatgaagcccttcagcacaccggttctc
tccaagcgaacctaccgtgagctgaagcttctcaagcatctcaagcacgagaacgtgatc
agcctcagcgacatcttcatttcgcctctggaagacatctattttgtgaccgaattgctc
ggcaccgatctccaccgcctcctcacgtcgagaccgctcgagaagcagtttatccagtac
tttctgtaccaaatcctccgcggcctgaaatacgtccactccgccggtgtcgttcaccgt
gacctcaagccctccaacatcctggtgaacgagaactgcgacttgaagatttgtgacttt
ggtctggcccgtattcaggatccacaaatgacgggatatgtctcgacgagatactaccga
gctcctgagatcatgctcacgtggcaaaagtacgatgtagaagtggatatctggagtgcg
ggatgcatctttgcggaaatgctcgagggcaagcccctgtttccaggaaaggatcacgtc
aaccagttctcgatcatcacggatttgttggggacaccaccagatgatgttatcagcacc
atctgcagcgagaataccctcagattcgtgcagtcgcttcccaagcgtgaacgccagccg
ctcaagaacaagttcaagaacgccgacccacaagcgatcgagctcctcgagcgtatgctt
gtcttcgacccacggaaacgcgtcaaggctggcgaggctctggccgacccatacctctca
ccataccacgaccctactgacgagccagaggcggaagagaagtttgattggtcgttcaac
gacgcagatctgcccgtggacacctggaagatcatgatgtactccgaaatcctcgactac
cataacgtggactctgcgaacaacggagagggccaggagaacggcggcgcataa

DBGET integrated database retrieval system