KEGG   Zymoseptoria tritici: MYCGRDRAFT_76502Help
Entry
MYCGRDRAFT_76502  CDS       T02285                                 

Gene name
MgHog1
Definition
(RefSeq) MAP kinase
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr04011  MAPK signaling pathway - yeast
ztr04139  Mitophagy - yeast
ztr04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    MYCGRDRAFT_76502 (MgHog1)
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    MYCGRDRAFT_76502 (MgHog1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    MYCGRDRAFT_76502 (MgHog1)
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MYCGRDRAFT_76502 (MgHog1)
Protein kinases [BR:ztr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   MYCGRDRAFT_76502 (MgHog1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo APH Kinase-like FTA2 RIO1
Motif
Other DBs
NCBI-GeneID: 13398465
NCBI-ProteinID: XP_003849068
JGI: Mycgr3_76502
UniProt: Q1KTF2
Position
10
AA seq 357 aa AA seqDB search
MAEFVRAQIFGTTFEITSRYTDLQPVGMGAFGLVCSAKDQLTGQAVAVKKIMKPFSTPVL
SKRTYRELKLLKHLKHENVISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITDLLGTPPDDVIST
ICSENTLRFVQSLPKRERQPLKNKFKNADPQAIELLERMLVFDPRKRVKAGEALADPYLS
PYHDPTDEPEAEEKFDWSFNDADLPVDTWKIMMYSEILDYHNVDSANNGEGQENGGA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattcgtgcgtgcgcagatcttcggcacgacctttgagatcacgagccgatac
accgatcttcaacccgtcggcatgggcgccttcgggctggtatgctcggcaaaagatcag
ctcaccggccaggccgttgccgtgaagaagatcatgaagcccttcagcacaccggttctc
tccaagcgaacctaccgtgagctgaagcttctcaagcatctcaagcacgagaacgtgatc
agcctcagcgacatcttcatttcgcctctggaagacatctattttgtgaccgaattgctc
ggcaccgatctccaccgcctcctcacgtcgagaccgctcgagaagcagtttatccagtac
tttctgtaccaaatcctccgcggcctgaaatacgtccactccgccggtgtcgttcaccgt
gacctcaagccctccaacatcctggtgaacgagaactgcgacttgaagatttgtgacttt
ggtctggcccgtattcaggatccacaaatgacgggatatgtctcgacgagatactaccga
gctcctgagatcatgctcacgtggcaaaagtacgatgtagaagtggatatctggagtgcg
ggatgcatctttgcggaaatgctcgagggcaagcccctgtttccaggaaaggatcacgtc
aaccagttctcgatcatcacggatttgttggggacaccaccagatgatgttatcagcacc
atctgcagcgagaataccctcagattcgtgcagtcgcttcccaagcgtgaacgccagccg
ctcaagaacaagttcaagaacgccgacccacaagcgatcgagctcctcgagcgtatgctt
gtcttcgacccacggaaacgcgtcaaggctggcgaggctctggccgacccatacctctca
ccataccacgaccctactgacgagccagaggcggaagagaagtttgattggtcgttcaac
gacgcagatctgcccgtggacacctggaagatcatgatgtactccgaaatcctcgactac
cataacgtggactctgcgaacaacggagagggccaggagaacggcggcgcataa

DBGET integrated database retrieval system