KEGG   Zymoseptoria tritici: MYCGRDRAFT_76502Help
Entry
MYCGRDRAFT_76502  CDS       T02285                                 

Gene name
MgHog1
Definition
MAP kinase
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ztr  Zymoseptoria tritici
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ztr04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 357 aa AA seqDB search
MAEFVRAQIFGTTFEITSRYTDLQPVGMGAFGLVCSAKDQLTGQAVAVKKIMKPFSTPVL
SKRTYRELKLLKHLKHENVISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITDLLGTPPDDVIST
ICSENTLRFVQSLPKRERQPLKNKFKNADPQAIELLERMLVFDPRKRVKAGEALADPYLS
PYHDPTDEPEAEEKFDWSFNDADLPVDTWKIMMYSEILDYHNVDSANNGEGQENGGA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattcgtgcgtgcgcagatcttcggcacgacctttgagatcacgagccgatac
accgatcttcaacccgtcggcatgggcgccttcgggctggtatgctcggcaaaagatcag
ctcaccggccaggccgttgccgtgaagaagatcatgaagcccttcagcacaccggttctc
tccaagcgaacctaccgtgagctgaagcttctcaagcatctcaagcacgagaacgtgatc
agcctcagcgacatcttcatttcgcctctggaagacatctattttgtgaccgaattgctc
ggcaccgatctccaccgcctcctcacgtcgagaccgctcgagaagcagtttatccagtac
tttctgtaccaaatcctccgcggcctgaaatacgtccactccgccggtgtcgttcaccgt
gacctcaagccctccaacatcctggtgaacgagaactgcgacttgaagatttgtgacttt
ggtctggcccgtattcaggatccacaaatgacgggatatgtctcgacgagatactaccga
gctcctgagatcatgctcacgtggcaaaagtacgatgtagaagtggatatctggagtgcg
ggatgcatctttgcggaaatgctcgagggcaagcccctgtttccaggaaaggatcacgtc
aaccagttctcgatcatcacggatttgttggggacaccaccagatgatgttatcagcacc
atctgcagcgagaataccctcagattcgtgcagtcgcttcccaagcgtgaacgccagccg
ctcaagaacaagttcaagaacgccgacccacaagcgatcgagctcctcgagcgtatgctt
gtcttcgacccacggaaacgcgtcaaggctggcgaggctctggccgacccatacctctca
ccataccacgaccctactgacgagccagaggcggaagagaagtttgattggtcgttcaac
gacgcagatctgcccgtggacacctggaagatcatgatgtactccgaaatcctcgactac
cataacgtggactctgcgaacaacggagagggccaggagaacggcggcgcataa

DBGET integrated database retrieval system