KEGG   Zymoseptoria tritici: MYCGRDRAFT_76721Help
Entry
MYCGRDRAFT_76721  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MYCGRDRAFT_76721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11
AA seq 223 aa AA seqDB search
MAWRCSGVTNEALINNMLEAGLINSPRVSEAMKSVDRAHYAPEAPYQDSPQSIGHRATIS
APHMHAAAAESLLLYLRPGASVLDVGSGSGYLTHVLAALVQPGGKVVGVEHITALRDMGE
SNMKKSQEGKALLEGKIVEFVKADGRLGWRSGAPWDAIHVGAAANGLPDHLVEQLKAPGR
LFIPVEENGSQHIYVIDKSADGTVTKKREIGVRYVPLTDAPAG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcggtgctccggagtcacgaatgaggcactaattaacaacatgctcgaggcg
ggcctcattaacagtcctcgcgtcagcgaagccatgaagagcgtcgaccgagcccactac
gctcccgaagcaccctatcaagactcaccgcagtccatcggtcaccgcgcgacgatctcc
gctccacacatgcacgccgcagctgccgagtcactcctcctttacctccgccctggagcg
tcagtcctcgacgttggaagcggtagcggctacctcacacacgtactcgcagcattagtg
cagccgggcgggaaggtggtgggcgtggagcatattactgcattgagggatatgggagag
agcaatatgaagaagagccaggagggaaaggcattgctggaagggaagattgtggaattt
gtgaaagcggatgggagattgggatggaggagcggtgcgccgtgggatgcgatacatgtt
ggtgcggcggcgaacggattgcctgatcacttggtggagcagctgaaggcgccggggagg
ctgttcattcccgttgaagagaatggctcgcagcatatctatgtcattgacaagtctgct
gacggcacggtgacgaagaagagggagataggcgtgcgatacgtgcctttgacagatgcg
cctgcggggtga

DBGET integrated database retrieval system