KEGG   Zymoseptoria tritici: MYCGRDRAFT_77815Help
Entry
MYCGRDRAFT_77815  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ztr  Zymoseptoria tritici
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ztr00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 954 aa AA seqDB search
MAAFDEKSAPRRRSDLPQSRTSVAAPAPTLVQTSPDKPPYPNGTYTSVGVRDNNILNLKS
SDWQLCGVVTLIALFVRLFRIYQPTSVVFDEVHFGGFASKYIKGRFFMDVHPPLAKLLIT
LAGWLAGFDGNFDFKDIGKDYLEPQVPYVAMRLLPALLGVLSVPTMYLTLKAVGCRSVTA
FLAAGLLTFENGFTTQSRLILLDSPLIGFTALTALSWFSFINQHELGPRYAFTPSWWFWL
AATGLTLGATASVKWVGLFTIAWVGSLTVLQLWVLLGDTRNVTTRVWFKHLFARIFCLII
IPVGFYMAMFAIHFICLVNPGDGDGFMSSEFQSTLNSKGMADVPADVAFGSRISIRHHNT
QGGYLHSHPHMYPTGSKQQQITLYPHKDDNNVFLVENQTQPIDWAADPTGNTSVVGPLAW
DSLKPEWIVDGSILKLYHLSTDRRVHSHDVRPPVTEAEWQNEVSAYGYKGFAGDANDLFR
VEIQKKMSDGAVAKERLRTIETKFRLIHIMSGCALFSHKVKLPKWGFEQQEVTCAKQGTL
PNSIWYVESNVHPNMGQDAEKVNYRNPGFFGKFWELQQVMWTTNAGLVDSHAWDSRPPSW
PLLSRGINFWGKDHRQIYLIGNPLIWWASTAAIGLYFAFKGLALLRWQRACNDYQDLTFR
RFDYEVGMTVLGWGFHYFPFFLMQRQLFLHHYFPALYFAIIALCQIFDFNFNRIKVGAFT
LRDKPVAGWGVATVFLALSVVVFSLYAPLGYGNTWTKSECNRVKLFSTWDWDCNNFYDSY
AEYSLAVPSAAGAAVQTPQAAVGGPAPPVAEDPAKEVVVTPGADVNDAGVEDYTEERIEY
RDEEGNLLDPEEVAAMEGEVSFSTRYETKTRMVDQYGNEVEGDGDFVEEGQDVEAGTRAD
GVDQETKGEVEAGEEKTVPAENVRVAEDLAKEEVVVQEAKATGEAKAEQGRDEL
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctttgacgaaaagtcagccccacgaaggcgctccgacctgccgcagtcgaga
accagcgtcgctgcgccagcgcccaccctcgtccaaaccagcccagacaagccgccctat
cccaatggcacctacacatccgtcggcgtgcgcgacaacaacatcctcaacctcaagagc
agtgattggcagctatgcggagtcgtcaccctgattgcgctgttcgtgcggctctttcgc
atctaccagccgaccagcgttgtgttcgacgaggtacactttggaggattcgccagcaag
tacatcaagggcaggttcttcatggacgtccacccgccgctcgccaagctgttgatcacc
ctggcgggctggctcgctgggttcgatggcaacttcgacttcaaggatattggaaaggac
tacctcgagcctcaagtgccatatgtggccatgcgactgctgcctgcgctgctgggagtg
ctctctgtgccgaccatgtacctcacgctcaaggctgtgggctgcaggagcgtcactgct
ttcctcgctgcgggacttctcacctttgagaacggcttcaccacccaatctcgattgatc
ctcctggactcgccattgatcggcttcacagccctcactgcgctgtcgtggttctccttc
atcaatcagcatgagcttggcccgagatatgccttcactcctagctggtggttctggttg
gccgcaactggtctcacgctgggcgcaaccgcgagtgtcaagtgggttggtctcttcaca
atcgcttgggtcggctctttgaccgttctccaactttgggtccttctcggcgataccagg
aatgtcaccactcgcgtctggttcaagcacctttttgcccgcattttctgcttgatcatc
atcccggtcggtttctacatggccatgtttgccattcacttcatctgcctcgtcaaccca
ggtgacggcgatggtttcatgagcagcgagttccagtctacgctcaactctaaaggcatg
gcagatgttcctgccgacgttgcattcggttcgcgcatcagcattcgtcaccacaacacc
cagggaggatatctgcactcccacccgcacatgtacccgacgggtagcaagcagcagcag
attactctgtacccgcacaaggatgacaacaatgtctttctggttgagaaccagactcaa
cccattgactgggcggcggacccgactggcaacacatccgtcgtaggaccactggcgtgg
gacagcctgaagccagagtggattgttgatggtagcatcctcaagctttaccacctcagc
accgaccgtcgcgttcactcgcatgacgtccgcccaccggtcactgaggccgagtggcag
aacgaggtttcagcgtacgggtacaagggcttcgctggagacgccaacgatcttttccga
gtcgagattcagaagaagatgtccgatggtgctgttgccaaggagcgcctgcggactatt
gagaccaagttccgactgatccatatcatgtctggatgtgctctcttctcgcataaagtc
aagctaccgaagtggggatttgagcagcaagaagttacctgcgctaagcagggaactctt
cctaacagcatctggtatgtcgaaagcaacgtccaccccaatatgggccaagacgccgaa
aaggtcaactaccgcaacccgggtttctttggcaaattctgggagcttcaacaagtgatg
tggaccaccaacgccgggctggtcgactctcacgcttgggactcgcgccctccatcgtgg
cctcttctctctcgcggtatcaacttctggggcaaagatcatcgtcaaatctacctcatt
ggcaacccacttatctggtgggccagcactgccgccattggactctacttcgcattcaag
ggtctcgctctcctccgctggcaacgcgcctgcaacgactaccaagatctcacattccgc
cgcttcgactacgaggtcggcatgacggtcctcggctggggcttccactacttcccattc
ttcctcatgcagcgtcagctcttcttgcaccactactttcccgcactgtactttgccatc
atcgctctgtgccagatctttgacttcaacttcaaccgcatcaaggttggtgctttcacc
ctccgcgacaagcctgtcgcaggatggggtgtcgccacggtcttcctcgcgctgtcggtc
gtcgtcttctccctgtacgctcctctcggctacggcaacacatggaccaaatccgagtgc
aaccgcgtcaagctcttctcgacttgggactgggactgcaacaacttctacgactcctac
gccgaatactcccttgccgtcccctccgcagccggcgccgccgtgcagacccctcaagca
gccgtcggcggtcccgccccacccgtcgctgaagatccggccaaagaagtcgtcgtcacc
cccggcgcagacgtcaacgacgccggcgtggaagactacacggaagaacgcatcgagtac
cgcgacgaagaaggcaacctcctcgacccggaggaagtggccgccatggagggagaagtc
agcttctccacgcgttacgagacgaagacgaggatggtggatcagtatgggaatgaagtc
gagggtgatggagattttgtcgaggaaggacaggatgttgaggcgggtaccagggcggat
ggcgtggatcaggagacgaagggagaggtggaggctggggaggagaagactgtgccggcg
gagaatgtgagagttgcggaggatttggcgaaggaggaggttgtggttcaggaggccaag
gcaacgggagaggcgaaggcggagcaggggagggatgagttgtga

DBGET integrated database retrieval system