KEGG   Zymoseptoria tritici: MYCGRDRAFT_77882Help
Entry
MYCGRDRAFT_77882  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ztr  Zymoseptoria tritici
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 1406 aa AA seqDB search
MRQRPTKEDVRRSGKKKKELNMRHGWEAQLSNEEVTRSLSENFFMYYEERRHETAGNLPP
GYDPASVLTEWRMKDRLKTVSALLAVCLNVGVDPPDVIKTNPCARLECWVDPVPPDSTNQ
SSNNTNAQIGKNLQSQYENLSLRTRYKVILDPTIEELKKYTTQLRRTAHAERLLFHYNGH
GVPKPTQSGEVWCFNRSYTQYIPISLYDLQEWVGAPGLWVWDCSAAGGIIQGFLEAAQKH
NLSQQEALQKDPNRAQQQAITKWEDCIHLAACRENEVLPTNPDLPADLFTSCLTTPIMMA
VRFFILQNPLTSTSGVSLAQARNIPGKVSERRTPLGELNWIFTAITDTIAWNMLPKPLFK
KLFRQDLMVAALFRNFLLAQRVMRMYHCHPLSYPAIPNTYDHPLWKSWDLAVEMILSQLP
RLIEQQKANDAALEYQHSDFFADQLSAFEVYLTSAPSNPGAAGYAKPPEQLPIVLQVLLS
QVHRLRALILLSKFLDLGPWAVSLALSIGIFPYVLKLLQSQALELKAPMVFIWSRILAVD
SSCQTDLLKDHGFAYFTNILVSTNGIPMGNVAEHRAMCTFIIAIFCKDMNAAKMAVLDSN
PEVIDCCLRHLHDMENPLLRQFSLLCLSHMVRDCSPVKDQFLAQNGGSRIADRSHDPVAE
VRVACLNALTSFIATGDSADAWVEHGEELLVRRQEEHLIGVVITMGMDGSIMVRRELTVL
YSEFVLKYMPRFLTAAWEQLLEEQDKKRGQEQNADDFVAMQAIEGSNDLQMINGTRAAIS
HNRSAAETSRGTVYRAVWRQLMSLSADPHPEISKNAGAIVDNVLNAVLESPLGTHAEAIL
DSLQSQEPIVDIILPATTPTASEALTKTKSNDTRPETPPSPAPSSASRPDGYFALSRTAS
VAAAMKNLIGWGPKTPGEPSSPGSPTHTRRNSAATPYRSRPLTPYDAALLPPDALDNITG
RPPHQPPANVPPTPFFKRREKNTLPDLPLKSEFFEWASSHFREVQMRPNEADEPGSKDYN
ERLWRRNRNDKIIASTQPLKEAAGSTPWDKPCGYFGIGAAPVKMVFHQFENHLVTSDDRD
SIAVWDWSAERQLHRFSNANPRGSRVTEVRFINEDDTAMLMIGSSDGVIKIYRNYESPEH
CHHVASFRALSDLVPSDKGGSGLVFDWQQGQGKALVAGDDRVVRVWGVGTELAIRDIGTR
SSACITSLTSDQVEGNIFVAGFGNGSVKAYDQRCEDKDTLVRGWNEHKSWIVGVHLQRGG
MRELISADSSGHIRLWDLRYPGAVAAINPPASRQEPRSLRTLSVHEHAPVFATGGKDHTI
RVYNTDLKPLSTFEPYMSYLRVGLSGAPRNAPITATAFHPHRMMLACGAVNDGHVNLFKC
DVEAEERGVLSSNVDAGQGVVQEWRG
NT seq 4221 nt NT seq  +upstreamnt  +downstreamnt
atgcgacagcgaccgacgaaagaggatgtgcgaagatcgggcaagaagaagaaagagttg
aatatgcggcacggctgggaggcacaactttcgaacgaagaggtcacacgcagcctgagc
gagaacttcttcatgtactatgaggaaaggcgacatgagactgctgggaatctgccgccg
ggatatgatccggcgagtgtgctgaccgagtggcgcatgaaagatcgtctgaagaccgtc
tcggcactgctcgcggtctgtttgaatgttggagttgaccctccggatgtgatcaaaacc
aatccttgtgcccgtctggagtgctgggtcgatcctgttccgccggacagcacaaaccag
agctcgaacaatacaaacgcacaaatcgggaagaatctacagtcacaatacgagaacttg
tcactgcggacgcgatacaaggtcattctggatcccacgatagaggagctgaaaaagtac
accacacaacttcggcggacggcacatgcagagcggctactgtttcactacaatggtcat
ggtgtgccgaagccgacacaaagtggagaggtctggtgcttcaacagaagctacacacaa
tacattcccatcagtctatacgatctccaagagtgggtaggtgctccaggactttgggtg
tgggattgcagtgcagcaggtggtatcatccaaggtttcctagaagcggcgcagaaacac
aatctgagccagcaggaagctctgcaaaaagacccgaaccgcgctcaacagcaggccatt
acaaagtgggaagactgcatacatcttgcggcttgtcgagagaatgaagtgctccccacg
aatcccgaccttccggcagatcttttcacttcttgcctcacgactccaatcatgatggcg
gtacgattcttcatcctgcaaaatccactaacttccacatcgggcgtcagtcttgcccag
gcacggaacattcctggcaaagtcagtgagcgtagaacgccgttgggcgaactgaattgg
attttcacggcgatcacggatacgatcgcatggaacatgcttcccaagcctcttttcaag
aagctcttccggcaagacttgatggtggctgcattgttccgaaattttctcctggcacaa
agagtgatgcgaatgtaccactgtcatccgctgtcatatcctgccatccccaatacgtac
gatcatccactgtggaagagctgggatctggctgtggagatgattctttctcagcttccg
aggctgatcgaacagcagaaggcgaatgatgcggctcttgagtaccaacattcggacttc
ttcgccgatcaactgtccgcgtttgaagtgtacctcacttctgctccgagcaatcctggc
gcagcagggtatgccaaaccgccagagcaattgccgatcgtcctgcaagtgttactttcg
caagttcaccggctgagagcgctcattttgttgtccaaattcttggatcttggcccatgg
gcggtcagtcttgctctcagcattggaatcttcccctacgtgttgaagcttttgcagtct
caagctctcgaactcaaggctcccatggtgttcatttggtcgaggattcttgcggtggac
tcaagctgccagactgatctgctcaaggatcatggctttgcttactttacgaacattctc
gtctctaccaacggcattcccatgggtaatgttgctgaacatcgagcaatgtgcactttt
atcatcgcaatcttctgcaaggacatgaacgctgcgaaaatggctgttctcgacagtaat
ccagaagtcatcgattgttgcctgcggcacctccacgacatggagaatccactgttgcgg
cagttcagcttgctttgcttgagtcacatggtgcgagactgctcgcccgtaaaggatcaa
tttctcgcccagaatggtgggagtcgcatcgcagatcgtagtcacgaccctgtagcagag
gtccgggtggcctgcttgaacgccttgactagctttatcgccacgggtgattctgctgat
gcgtgggttgagcatggagaagaactccttgtacgacgacaagaggagcatctgattggc
gtcgtcatcactatgggaatggacggctccatcatggtgcgaagagaattgacggtgctg
tattcagagtttgtgctcaaatatatgcctcgctttcttaccgctgcgtgggagcagctt
ctcgaagaacaggacaagaagcgtgggcaagagcagaatgccgatgacttcgttgcgatg
caggcaattgaagggtcaaatgatcttcagatgatcaacggcacaagagcagccatatcg
cataatcgtagtgcagctgaaacatctcgcgggactgtataccgcgctgtgtggcgtcaa
ttgatgagcctttcagcagacccacatccagaaatctcgaagaacgccggtgccatcgtc
gataatgtgctcaatgcggtcctcgagtctccgctaggtacccacgccgaggcaatactc
gacagcttacaatcacaggagccgattgtcgacattattctccctgccaccacaccaact
gcatcggaagcactgacaaagacgaagtccaacgacacgcggccagaaacgcctcctagt
cctgcgccatcttcggcttcaagacccgatggctattttgccctttcgcgcactgccagt
gtcgctgctgcaatgaagaatctcatcggatggggtccgaaaacaccaggcgagccatca
tcccccggctcacctacgcacactcgtcgaaattccgcagccacaccctaccgatcacga
ccactcacgccatacgacgctgcactgctgccaccggacgctcttgataatattacaggg
cgtccgccgcatcagccgcccgcgaacgtccctccgacaccattcttcaagagacgcgag
aagaatactcttcctgatctgccgttgaaatccgaattcttcgaatgggcctcctcccac
ttccgcgaagtccagatgcgaccgaatgaagccgacgagccagggtcgaaagactacaat
gagcgactatggcgacggaaccgtaacgacaagatcattgcctcaacacaaccactgaag
gaagctgccggcagcacaccttgggataaaccttgcggctacttcggtatcggcgctgct
cctgtgaagatggtcttccaccaattcgaaaaccacctcgtcacctccgacgatcgggac
tccatcgccgtctgggactggtcagcagaacgtcaactccaccgcttctccaatgccaat
cctcgcggctcccgtgtgacggaagtccgcttcatcaacgaagatgacacagccatgctc
atgatcggatcttcggatggtgtcatcaagatctaccgcaattacgaatctcccgagcac
tgccaccatgtcgcttccttccgcgctctctccgatctggttccctccgacaaaggcgga
tccggtctcgtgttcgactggcaacaaggccaaggcaaggctcttgtggctggagatgac
cgcgtcgtccgcgtctggggcgtcggaaccgagctcgctatccgcgatatcggcacaagg
tcttctgcatgcatcacgtccctcacctccgaccaagtcgaaggcaacattttcgtcgcc
ggttttggtaatggtagcgtcaaagcttacgaccaacgctgcgaagacaaagacaccctc
gtccgcggctggaatgagcacaaatcgtggatcgttggcgtgcacctccagcgtggaggt
atgcgcgagctcatctccgctgactcgagcggccacattcgactctgggacttgcgctac
cctggggccgtggctgccatcaaccctcctgcttctcgacaagagccgcgcagtctacga
acactcagcgttcacgaacatgcgcctgtgtttgcaacgggaggtaaagatcatacgatt
agagtgtacaacacggatctcaaaccactcagtacgtttgagccgtatatgagttatttg
cgggttggattgagcggtgcgccgaggaatgcgccaatcacggcgacggctttccatccg
caccgtatgatgttggcttgtggggcggtgaatgatgggcatgtgaatttgttcaagtgt
gatgttgaggcggaggagaggggtgtgttgagtagtaatgttgatgctggacagggtgtt
gtgcaagagtggaggggttga

DBGET integrated database retrieval system