KEGG   Zymoseptoria tritici: MYCGRDRAFT_77923Help
Entry
MYCGRDRAFT_77923  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
ztr  Zymoseptoria tritici
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 498 aa AA seqDB search
MANGGFQLPQTAPLAEALKQYNVHSGSKLAFLEPRGLVNTGNMCYMNSILQVLVFCAPFY
SFLDQVRQRTVHSMKSDTPLVDAMIMFMREFKVLADAESADALRKTLKQDQLEVYGDPVT
PEYVYEVIRKLPRFASMRRGHQQDAEEFLGFLLEGLHDECVHVMQGQMDEPKENGVTSPD
TVIAEGWLEVGPKQKASVTRTAGQQDAPSPVTKIFGGHLRSELRVPGQKDSVTLEPYQPL
QLDIGAPHVNNIIDALKGITRTETLTGDFGGKGSTAKKQVFIDTLPPVLILHLKRFQYDN
SQTGTQKIWKRVGYPLELEIPKDVFPPAKRGGLAVKGGLPRYRLTGVVYHHGKSAAGGHY
TVDVLRQDSREWVRMDDTVIRRIRPEDVAEGGSEEDPKLLAKALEQHKADADMQKQRNMY
QGLDEAEKEPEEEKPWSEVNAYVNGHAKKWSNVAVGATNGTATPASTTGKRTPTNAARKE
GVRDNKVAYILLYERMRD
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctaatggtggattccaactcccgcagaccgcgccgcttgccgaggctttgaagcag
tacaatgtccacagtggctcaaagttggcatttctcgagccaagaggactcgtcaatact
ggcaacatgtgttatatgaattcgattctccaagtcttggtcttttgtgctcccttctac
agcttcctggatcaagtccgccagcgaactgtgcactccatgaagagcgacacacctctt
gttgatgcgatgattatgttcatgcgggagttcaaagttttggctgacgcggagtcggcg
gatgctctccgaaagactctcaagcaggatcagctggaggtgtatggcgatcccgtcacg
ccggaatatgtttacgaggtgattaggaagctgcctcgatttgcgagcatgaggcgcgga
catcagcaggatgcggaagaattcctcggattcctgctcgaaggattgcacgatgagtgc
gttcacgtcatgcaaggacagatggatgagccaaaggagaacggcgtcacatctccggat
acagtcattgctgaaggctggctcgaagttggtcccaagcagaaggcttcggtgacccgc
acagccggacagcaagatgcgccatcaccggtcaccaagatcttcggtggccacctccga
tcagagttgcgtgtgccagggcagaaagactctgtcacactggagccataccaaccactg
cagctcgacattggagctccgcacgtgaacaacatcatcgacgctctcaagggcatcact
cggactgagacattgaccggcgactttggcggcaaaggcagcaccgccaagaagcaagtc
ttcatcgataccctcccaccagtcctcattctccacctcaagcgcttccaatacgacaac
tctcaaaccggcacccagaagatctggaagagagtcgggtacccactcgaactcgagatt
ccaaaggacgtcttcccaccagccaaacgcggtggactggctgtcaaaggcggccttcca
cgataccgcctcacgggcgtcgtctaccaccacggcaaatccgccgccggaggacactac
accgtcgacgttctgcgtcaagacagccgcgagtgggtgcgcatggacgataccgtcatc
cgtcgcatccgtccggaagacgtggccgaaggcggttcagaggaagatccgaaactcctg
gcgaaggcattggagcagcacaaagctgatgcggacatgcaaaagcaacgcaacatgtac
caggggcttgacgaggccgagaaggaacctgaagaggagaagccgtggtcggaagtcaat
gcatatgttaacgggcatgcgaagaagtggagcaatgttgctgttggtgcgacgaatggg
acggccacgccggcgagtacgaccggaaagaggacgccgacgaatgcggctaggaaggag
ggagtgagggataataaggtggcgtacattttgttgtatgagaggatgagggattga

DBGET integrated database retrieval system