KEGG   Zymoseptoria tritici: MYCGRDRAFT_83726Help
Entry
MYCGRDRAFT_83726  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ztr  Zymoseptoria tritici
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCGRDRAFT_83726
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MYCGRDRAFT_83726
Enzymes [BR:ztr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MYCGRDRAFT_83726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 560 aa AA seqDB search
MASTLSPVNPPLPSTQPTDSFQLLKESEKPDAEQEIFDQQVQQVKEWWASPRYKGIKRPY
QPEQVVSKRGTLQQVYPSSLTARKLFNLLEERNAEGKPVHTMGAIDPIQMTQQAAHQEIL
YVSGWACSSVLTTTNEVSPDFGDYPYNTVPNQVQRLFKAQQLHDRRSYDARMKMSPEERK
KTPYIDYLRPIVADGDTGHGGLSAVLKLAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVL
VPVGDHISRLVAARFQWDLMGCENLVIARTDSESGKLLSSAVDARDHEFILGVTEDVEPL
AETMQIMEMNGASGPEIDKFEADWVKNHKLVTFDEAAEAHINAAGKDAGAYLKQIKENRN
LPLYQRRKAAAEVAGSPVLFNWDAPRTREGFYHYKAGLAAATKRAIAFGPYADLLWLETG
DPSVAKAAGFAKEIRDVLPEKKLVYNLSPSFNWSAHGFSDHDLKNFIWDLAKHGFVLQLV
SLAGLHSTATISNELAKAYKTEGMKAYVEIVQRREKETGCDVLTHQKWSGSNYMDGIIGS
IQAGSSGSKSMGDGNTEGSF
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgacactctcgccagtcaacccacctctaccttcgacccagccgaccgactcg
ttccagctgttgaaggaatcggagaaaccagatgccgagcaagagatattcgatcaacag
gtacaacaggtcaaggagtggtgggcgagtccgagatacaagggcatcaagcgtccatac
caaccggaacaagttgtgagcaagcgtgggactcttcaacaggtctatccttcgagcttg
acggctcggaaactgttcaacttgttggaagaacgaaatgctgagggcaagcccgtacat
acaatgggtgccattgacccgatccaaatgacacaacaagctgcacatcaggagatcctc
tatgtctccggctgggcttgctcctccgtactcacaacgacgaacgaagtcagcccggat
tttggcgactacccatacaacacggtacccaaccaggtccagcgattgttcaaggcgcag
cagttgcacgacaggagaagttacgatgcgaggatgaagatgagcccagaagagcgaaag
aagacaccatacatcgattatctccgacctattgtagcagacggcgacactggacatgga
ggtctcagtgctgttctcaagctggcgaagttgtttgcggagaatggtgcggcggcagta
catttcgaggatcagcttcacggcggaaagaaatgcggacatcttgcgggcaaggtgttg
gttccagtcggtgatcacatcagccgccttgtagctgcacggttccaatgggatttgatg
ggctgcgagaacctggttattgctcgcaccgacagcgagagtggaaagctgctcagcagt
gctgtggatgctagggaccacgaatttatcctcggagtgacagaagatgtggagccactc
gccgagacgatgcagattatggagatgaatggtgcatcaggacctgagatcgacaagttc
gaggccgactgggtcaagaaccacaagctggtcacattcgacgaggccgcggaggcacac
atcaatgctgccggcaaagacgctggagcatacctgaagcagatcaaggagaatcgcaac
ctgccgctgtaccagcgaaggaaggcggcggcagaggttgcaggcagccctgtgctgttc
aactgggatgctccgcgcacacgagaaggcttttaccactataaagccggtcttgccgca
gccacgaagcgtgccatcgcttttggaccctacgctgatctcctgtggctagagaccggc
gacccaagcgttgcgaaggccgccggctttgccaaggagatccgcgacgtgctgcccgag
aagaagctggtctacaacttgtcacccagcttcaactggtctgcccacggcttcagcgat
cacgatttgaagaacttcatttgggaccttgccaagcacggcttcgtactccagctcgta
tctctcgccggtttgcacagcacagcgacgatctcgaacgagctggcgaaggcgtacaag
actgagggcatgaaagcgtatgtggaaatcgtgcagcggagagagaaggagacgggctgt
gatgtgttgacgcatcagaagtggagtggctcgaactacatggatggcattattggctcg
atccaggcgggcagcagtggcagcaagagtatgggagatggtaatacagagggatccttt
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system