KEGG   Zymoseptoria tritici: MYCGRDRAFT_84945Help
Entry
MYCGRDRAFT_84945  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ztr  Zymoseptoria tritici
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MYCGRDRAFT_84945
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MYCGRDRAFT_84945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 1474 aa AA seqDB search
MLGGLLLGVFTIVPSFLFWLIGFLTLTVPGWLFSFFSTSLTFTMNMTTLLLLLLVMASTV
SWFVRYRFLNMYSRLPPEPQRKEPQVEVFPDSQETDSKPGLANYFDEFLSAIKVFGYLER
PVFHELTRTMQTKKLIAGETLLLEEEKGFCLVVDGLVQIFVKSNRAPEHDSFNESAIVDD
DQNDERSGANGSYQLLTEVKNGAPMSSLFSILALFTDNVKLRYDEQENHMATSASAGNLR
NHMRSVPPDGGTPELGGYGGWNGPSSRPESRHNPDSVANGGMAFRDPPPFHLDESNETGQ
QRQSSRRPSTSRVGSGRGKPTTKAGSAHPDIVARATVDTTIAIIPASAFHRITRIYPKAT
AHIVQVILTRLQRVTLATANSYLGLTSEVLRTERLMDRYTNYDLPDFLRGEALQRLKDKF
RKDQERVGPEEGMKGIALHNPRLAHRRRTSSSLRRDVATQARMSVRNGSLHAGEMDGERS
GMSAGDLLTNIHAARSPGRRGQTGSFSQPYSAPRPAPGDANDPMKHQKRDSFSSGHNPRA
ALHRQESIDEDLIFRESIMECMAKAIGLTNSKEIFRRAASAAQSPHLVSYDSRKQSAVFN
NAFGFMEPFDGSQDDSESMISASAFSVGGSANILDDLKNEIEIVFFPKESVLVEEGERNP
GLYYVIDGFLDVSASVDAQEASSNVLGTMATSSAAEDLLGTGHRRAVSSAKRSTSVSGSE
ASRKKKAGQAKKSLFLIKPGGLAGYLGTISSHRSFIDVTAKTDVYVGFLPRIAIEKIVER
HPIVLLTMAKRMTSLLPRLILHIDFALEWVQVNAGQSIYHQKEDSDAIYIVLNGRLRAIQ
ESDDGKMKVTGEYGQGDSVGELEVLTETARSSTLHAIRDTELVKFPKTLFNSLAQEHPGI
TIKVSKIIASRMRALIENPMNESDSYNKLAVERPKVSTTSNLRTVAIIPCTAGVPVVEFG
NKLHNALNQIGTPNGVSVLSQSTILNHLGRHAFSKMGKLKLSQYLADLEEKYGLVIYVAD
ASVKSPWTQTCISQADCIYLVGLAEGSPAIGEYERFLLTTKTTARKELILLHTERYCPSG
TTRSWMRNRTWINGGHHHVQMAFRSSPEPVHPPQFKRFGTAIKQRVQVLQAEIHKYTSRK
VRQTPLYSAETPFKGDFHRLARRLCNKSVGLVLGGGGARGLAHVGIIRALEEAGLPIDII
GGTSIGSFVGAVYAQDADVVPMYGRVKKFAGRMGSVWRFALDVTYPSASYTTGHEFNRGI
FKTFGDSQIEDFWLEFYCNSTNITKSRSETHTSGYVWRYVRASMSLAGLIPPMCDEGNML
LDGGYTDNLTVAHMKALGADHIFAVDVGALDDDTPQAYGDSLSGFWASLNRWNPFSSYPN
PPTLSEIQARLAYVSSVDNLERAKKIPGCKYMRPPIEAYGTLDFGKFDEIYQVGYQYGKK
YLAELREEGVLPGVEETEEKRNLRRTMAPRRASI
NT seq 4425 nt NT seq  +upstreamnt  +downstreamnt
atgctgggaggtcttctcttgggtgtcttcacaatcgtaccttcatttctgttctggctg
atcgggttccttaccttgactgtgccaggatggctcttctctttcttctctacgagcctg
acattcacgatgaatatgacgactctgctattgctcctcttggtcatggcctcgactgtg
agctggttcgtgagatacagatttctgaacatgtactctcgacttccaccagagccgcaa
aggaaggaaccgcaagttgaggtcttcccggactcacaggagactgattcgaaaccagga
ctggccaactacttcgatgagtttctcagcgccatcaaagtcttcggatacctggagcga
ccggtgttccacgaattgacacggaccatgcagacaaagaagctgattgcgggcgaaacg
ttgctattggaggaagagaaaggtttctgtctcgtcgtggacggtttggtccagattttt
gtcaagtcaaatcgtgcgccggaacacgattccttcaatgagtctgcgatcgttgatgac
gaccagaatgatgagcgctctggggcgaatggcagctatcaacttctcaccgaggtcaag
aatggcgctcccatgtcttcattgttctcaatactggccttattcacagataacgtcaag
ctccgttacgacgagcaggagaatcacatggcaacgagtgcatccgctggaaacctcagg
aaccacatgcgttctgtaccaccggatggtgggacaccggagttaggcggctacggtggg
tggaatggaccctcttcgcgccccgaatccaggcacaatccagattcggtggcgaacgga
ggcatggcgttcagagacccgcctccatttcatcttgacgagagcaacgaaacgggtcag
cagcgacaatcaagtcgacgaccaagtacatctcgagttggcagcggccggggtaagcca
acgaccaaggcaggttcggctcatcctgacatcgttgcgagagctactgtcgatacaaca
atcgccatcattccagcgagtgcattccaccgcattacaaggatctatcccaaggcgact
gctcacattgtgcaagtcatcctcacgcggttgcagcgtgtcactcttgcgactgcaaat
tcatatctcggactcacgagcgaggttcttcgcacggaacgcttgatggaccgctacacg
aactatgatctgcctgatttccttcgaggcgaagcattgcaacggctgaaggacaagttt
cgcaaggatcaagagcgtgtcgggcccgaggagggcatgaaaggcattgcactgcacaac
cctcgtctcgctcatcggagacggactagtagcagccttcgccgtgatgtcgcaacgcaa
gcgcgcatgtcggtgcggaatggcagtctccatgctggcgaaatggatggtgaacgcagc
ggaatgagtgccggcgatttgctcaccaacatacacgcagcacggtctcccggacgcaga
ggccagaccggtagcttttctcagccgtactcggctcctcgaccggctcccggggacgcc
aacgatcctatgaaacaccagaagcgcgactcattcagcagcggccataaccctcgagcc
gctctccatcgacaagaatccatagacgaggaccttatcttccgagagtcaatcatggaa
tgcatggctaaagcaattggtctgaccaactccaaggaaatcttccgcagggcagcatct
gctgcccaatcaccacatctagtctcgtatgactccagaaaacagagcgccgtcttcaac
aatgcctttgggtttatggagccatttgatggctcacaggacgattcagagtccatgata
tccgcatcggcgttcagtgtgggtggctccgcaaatattctcgacgatttgaagaatgag
atcgagattgtattcttcccgaaggagtcggtacttgttgaagagggcgagcgaaatcct
ggattgtactatgtgatcgatggcttccttgatgtcagtgcatctgtcgacgcacaagaa
gccagctcaaacgtactcggcacaatggcaacttcttctgcggcagaagacctgctcggg
actggtcatcgacgcgctgtgtccagtgccaaaagatctacttctgtaagtggttcggag
gcctctcgaaagaagaaggcgggccaagcaaagaagagcttgttcttgatcaagccaggc
gggctcgcgggatatcttggaacaatctcgtctcaccgctcattcatcgatgtcactgcg
aagaccgatgtctatgttggatttctgcctcggattgccattgagaagattgtcgaacga
catcctatcgtactattgactatggccaagcggatgacaagcctgctacccaggctcatt
ctacacatcgacttcgctctggagtgggtgcaagtcaatgctgggcagtcaatataccat
cagaaagaagacagcgatgctatctacatcgtcctgaacggtcgactgagagccattcaa
gagagcgacgacggcaagatgaaggtgactggggaatacggccaaggcgacagcgtgggt
gagctggaagtgttgaccgagactgctcgttcgagcaccttgcatgcgattcgtgataca
gagcttgtgaagttccccaagacactctttaacagccttgcgcaggagcaccctggcatc
accatcaaagtgtcaaagatcattgcatctcgcatgagagcactcatcgagaatccgatg
aacgaatccgacagctacaacaagctcgcagtcgagcgtccgaaggtgtccacgacgtca
aaccttcggaccgtcgcgattataccttgcacagccggtgtgcctgttgttgagtttggc
aacaaacttcacaatgccctcaatcagattggtacaccaaatggcgtatctgtgctgagc
caatcgacgatcttgaatcatctcggccgacatgcatttagcaagatgggaaagctcaag
ctctctcaatatctggctgatcttgaagagaagtacgggcttgtcatctacgtcgcagat
gccagcgtcaagtcgccttggacgcagacttgtatcagccaagctgattgcatctacctc
gtgggtctcgcagaagggtctcccgcgatcggggaatacgagcgatttctactgaccacc
aagaccaccgcccggaaggaactgatcctgctacataccgagcgatattgtccctcggga
accactcgctcatggatgcggaacagaacttggatcaacggtggtcatcatcatgtgcaa
atggcgttcagaagttcgccggaaccggtccacccacctcagttcaagcgattcggcacc
gccatcaagcagcgagtgcaagttctgcaagccgagattcacaaatacacctcgcgcaaa
gtcagacagactccgctatactccgccgagacgcccttcaaaggcgacttccatcgtctt
gcgaggaggctgtgcaacaagagtgttggtttagtgcttggtggcggaggagctcgtggc
cttgcgcatgtgggaatcattcgcgcactggaagaagctggactgcccattgacatcatt
ggtggcacatcgatcggctcctttgtcggtgccgtctacgcacaagatgccgatgttgta
ccaatgtatggtcgggtcaagaagtttgccggccgcatgggcagcgtatggcgatttgcc
ttggacgtgacgtacccctccgcgtcctacaccactggtcacgaattcaatcgcggcatc
ttcaagacatttggcgacagccagatcgaagacttctggctggagttttactgcaactcg
accaacatcacaaaatcccgatccgagacgcacacaagcggatatgtctggcgatacgtg
cgtgcatcgatgtcgctggctggtcttatccctccgatgtgtgacgaaggcaacatgcta
ctcgatggaggctacacagacaatctcaccgttgcccacatgaaagccctgggcgcagac
cacatcttcgccgtcgacgtcggagctctagacgacgatacgccccaagcctacggcgac
agtctctccggtttctgggcctccctcaaccgctggaatcccttctcctcctacccgaac
ccacccaccctttccgagatccaggctcgcctagcatacgtgagttcagtagacaacctc
gaacgcgcgaagaaaattcccgggtgcaaatacatgcgacctccgattgaggcgtatgga
accctggacttcggcaaatttgacgagatttatcaggtcggatatcagtacggcaagaag
tatttggcggaattgagggaggagggcgtgcttccgggtgtggaggagacggaagagaag
cggaatttgaggaggacgatggcgccgagacgggctagtatttga

DBGET integrated database retrieval system