KEGG   Zymoseptoria tritici: MYCGRDRAFT_85175Help
Entry
MYCGRDRAFT_85175  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ztr  Zymoseptoria tritici
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    MYCGRDRAFT_85175
Enzymes [BR:ztr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MYCGRDRAFT_85175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 556 aa AA seqDB search
MPAPAADLAEALKKKGGLTLTQLADYDDILTDALVDRVYFWSTIRKLRANYHPCRGVLEE
DVCKTIQQHVIINKDPNTAQAKLLQLTGIAKYLKSLKSTDEKEHFQRHLKKYVNMYLSDC
PFEVGTTTRYTITTAEAAIIARKPIRKGESIKYLIGIQVEMTVEEEKDLSSRNDFSVVMS
SRRKRPSLFLGPARFANHDCDSNAKLTTTGPHGLHIVACKAIALGEEITVTYGEDYFGDD
NCECLCGTCERLQRNGWDPKGPILRHNDDDDSSEEEEDEKNDNAPPSRGLEGWKVVKGNS
GLARGPLNDNAKGKGRVHEESDEMERTSTSSKSKLPAINKQPHLTSLRNVINANETSSPS
SSGATDASSYTSTASSATSVETFSAGTIAQNICDMYTAEPEMDCDSPQPQIRRKSPRSNP
NSTDPVLSIEKPTTDDASSETTVDGERRGEPRTPGDYTLCKALLTTTYHRWVECRNCDEH
FVQAEAFLTRIACPRCERHSKLYGYYWPKTDKDGRNDREERVLDHRTIHRFIDPEEERRR
IRGLSRPTTPTPSTTL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgccagccgcagatttggccgaggccttgaagaaaaagggcggcctcactctt
actcagctcgccgactacgacgacatactcaccgatgcgctggtcgatcgcgtatacttc
tggtcaacgatccgcaaactccgagcaaattaccatccctgccgcggcgtgctcgaagag
gacgtttgcaagacgatacagcagcatgtcatcatcaataaggatccgaacactgcacag
gcgaaactgctacagttgaccggcattgcgaagtacctcaagagcttgaagtcgacggat
gagaaggaacacttccagcgtcatctcaagaaatatgtcaacatgtacctgtcagactgt
ccgttcgaagttggcaccaccacgcgatataccatcacaaccgccgaagccgcgatcatc
gcacgcaagcccatacgcaagggcgagtcgatcaaatacctcatcggaattcaggtggaa
atgacggtggaggaggagaaggatctgtcgagtcgaaatgatttcagcgtggtcatgtcc
agtcggcgcaagcggccttccctcttcctcggacctgcacgttttgcaaaccacgactgc
gactcgaatgcgaagctgacaaccaccggtcctcatggacttcacattgtggcttgcaag
gcgattgcgctgggagaggagatcacggttacttatggcgaggactattttggcgacgac
aattgcgaatgtctatgcgggacgtgtgagagactgcaacgaaatggatgggatccaaaa
ggtccgatattacggcataacgatgacgacgacagcagtgaagaagaggaggacgagaag
aacgacaatgcaccaccatcacgaggtcttgagggctggaaggtggtcaaaggcaacagt
gggctggccagaggtcctctgaacgacaacgcgaagggcaaaggcagagtccatgaggag
agtgatgagatggaacggacgtcgacttcgagcaagtcaaaactccctgcgatcaacaag
cagccgcatctcacgagtctgcggaatgtcatcaacgcgaacgagacttcctcaccgtcc
tcttctggagccaccgacgcgtcttcctacacgtccaccgcttccagtgccacgtctgtg
gaaacattttctgccggaaccatcgctcaaaacatctgcgatatgtacacggctgaaccc
gaaatggattgcgactcaccccagccccaaatccgccgcaaatcccctcgctctaatccc
aactccaccgatccagtcctctccatcgaaaagcccacgaccgacgacgcctcctccgaa
acgaccgtcgatggcgagcgtcgcggcgagccccgcactcccggcgactatactctctgc
aaagccctactcacaacgacctatcaccgctgggtcgaatgccgcaattgcgacgaacac
ttcgtgcaagccgaagctttcctcacccgcatcgcgtgcccgcgctgcgaacgtcactcg
aagttgtacggctactactggccgaaaacggacaaagatggaaggaacgatcgcgaggag
agagtgttggatcatcggactattcatcggtttattgatccggaggaggagaggagaaga
ataagagggctgtctagacctacgacaccgacaccgagcacaacgctataa

DBGET integrated database retrieval system